Target General Infomation
Target ID
T94918
Target Name
COVID-19 RNA-directed RNA polymerase (RdRp)
Synonyms
COVID-19 Pol; COVID-19 nsp12
Gene Name
COVID-19 rep; COVID-19 1a-1b
Target Status
Target in Phase 3 Trial
[1]
Disease [+] 1 Target-related Diseases +
1 COVID-19 [ICD-11: 1D6Y]
Function
Responsible for replication and transcription of the viral RNA genome.
BioChemical Class
Coronaviruses polyprotein 1ab family
UniProt ID
R1AB_SARS2(43935324)
EC Number
EC 2.7.7.48
Sequence
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKD
EDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLT
KYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGE
RVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSL
LMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN
CLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVN
LHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFY
DFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYF
DCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTIT
QMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHN
MLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECA
QVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYV
RNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIK
NFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGA
GCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML
DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ
Drugs and Modes of Action
Drugs in Phase 3 Trial [+] 2 Drugs in Phase 3 Trial +
1 Favipiravir Drug Info Phase 3 Trial COVID-19 [2], [3]
2 Remdesivir Drug Info Phase 3 Trial COVID-19 [4]
Drugs in Phase 2 Trial [+] 1 Drugs in Phase 2 Trial +
1 Lopinavir + ritonavir + ribavirin + interferon beta-1b Drug Info Phase 2 Trial COVID-19 [5]
Drugs in Phase 1 Trial [+] 1 Drugs in Phase 1 Trial +
1 Galidesivir Drug Info Phase 1 Trial COVID-19 [6]
Investigative agents [+] 3 Investigative agents +
1 Penciclovir Drug Info Investigative COVID-19 [7], [8]
2 Anidulafungin Drug Info Investigative COVID-19 [8]
3 Suramin Drug Info Investigative COVID-19 [8]
Mode of Action [+] 2 Modes of Action +
Inhibitor [+] 6 Inhibitor drugs +
1 Favipiravir Drug Info [9], [10]
2 Remdesivir Drug Info [1], [7]
3 Lopinavir + ritonavir + ribavirin + interferon beta-1b Drug Info [10]
4 Anidulafungin Drug Info [8]
5 Penciclovir Drug Info [7], [8]
6 Suramin Drug Info [8]
Blocker [+] 1 Blocker drugs +
1 Galidesivir Drug Info [11]
References
1 Comparative therapeutic efficacy of remdesivir and combination lopinavir, ritonavir, and interferon beta against MERS-CoV. Nat Commun. 2020 Jan 10;11(1):222.
2 ClinicalTrials.gov (NCT04336904) Clinical Study To Evaluate The Performance And Safety Of Favipiravir in COVID-19
3 ChiCTR.org.cn (ChiCTR2000030254) the Efficacy and Safety of Favipiravir for novel coronavirusinfected pneumonia: A multicenter, randomized, open, positive, parallel-controlled clinical study
4 ClinicalTrials.gov (NCT04315948) Trial of Treatments for COVID-19 in Hospitalized Adults
5 ClinicalTrials.gov (NCT04276688) Lopinavir/ Ritonavir, Ribavirin and IFN-beta Combination for nCoV Treatment
6 ClinicalTrials.gov (NCT03891420) A Study to Evaluate the Safety, Pharmacokinetics and Antiviral Effects of Galidesivir in Yellow Fever or COVID-19. U.S. National Institutes of Health.
7 Remdesivir and chloroquine effectively inhibit the recently emerged novel coronavirus (2019-nCoV) in vitro. Cell Res. 2020 Mar;30(3):269-271.
8 Suramin, Penciclovir and Anidulafungin bind nsp12, which governs the RNA-dependent-RNA polymerase activity of SARS-CoV-2, with higher interaction energy than Remdesivir, indicating potential in the treatment of Covid-19 infection. April.21.2020. Doi: 10.31219/osf.io/urxwh
9 Favipiravir versus Arbidol for COVID-19: A Randomized Clinical Trial. medRxiv. Posted April 15, 2020.
10 Therapeutic options for the 2019 novel coronavirus (2019-nCoV). Nat Rev Drug Discov. 2020 Mar;19(3):149-150.
11 BioCryst Begins Clinical Trial with Galidesivir for Treatment of Patients with COVID-19

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.