Target General Infomation
Target ID
T99041
Target Name
HUMAN dipeptidyl peptidase 4 (DPP-4)
Synonyms
Tcell activation antigen CD26; TP103; T-cell activation antigen CD26; Dipeptidyl peptidase IV; Dipeptidyl peptidase 4 soluble form; DPP-IV; DPP IV; DPP 4; CD26; Adenosine deaminase complexing protein-2; Adenosine deaminase complexing protein 2; ADCP2; ADCP-2; ADABP
Gene Name
DPP4
Target Status
Target in Phase 3 Trial
[1]
Disease [+] 2 Target-related Diseases +
1 COVID-19 [ICD-11: 1D6Y]
2 Middle East Respiratory Syndrome [ICD-11: 1D64]
Function
Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation.
BioChemical Class
Peptidase
UniProt ID
DPP4_HUMAN
EC Number
EC 3.4.14.5
Sequence
MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
Drugs and Modes of Action
Drugs in Phase 3 Trial [+] 1 Drugs in Phase 3 Trial +
1 Linagliptin Drug Info Phase 3 Trial COVID-19 [2]
Investigative agents [+] 1 Investigative agents +
1 YS110 mAb clone Drug Info Investigative MERS [3], [4]
Mode of Action [+] 2 Modes of Action +
Inhibitor [+] 1 Inhibitor drugs +
1 Linagliptin Drug Info [5], [6]
Blocker [+] 1 Blocker drugs +
1 YS110 mAb clone Drug Info [3], [4]
Tissue/Disease-Specific Protein Abundances of This Target
      Tissue-specific Protein Abundances in Healthy Individuals Click to Show/Hide
      ICD Disease Classification 01 Certain infectious or parasitic disease Click to Show/Hide
                  ICD-11: 1C1H     Necrotising ulcerative gingivitis Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.023205179; Fold-change: -0.131891231; Z-score: -0.240601956
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1E30     Influenza Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.594960063; Fold-change: 0.448392358; Z-score: 0.300779988
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1E51     Chronic viral hepatitis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.002379198; Fold-change: -0.507253251; Z-score: -1.752048286
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 1G41     Sepsis with septic shock Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.81E-67; Fold-change: -0.722175109; Z-score: -2.344895641
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA40     Respiratory syncytial virus infection Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.063730989; Fold-change: -0.243222414; Z-score: -1.133657942
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA42     Rhinovirus infection Click to Show/Hide
The Studied Tissue     Nasal epithelium tissue
The Specified Disease     Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.243741383; Fold-change: 0.008847858; Z-score: 0.044708802
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: KA60     Neonatal sepsis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 5.56E-18; Fold-change: -0.726312494; Z-score: -1.711679697
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 02 Neoplasm Click to Show/Hide
                  ICD-11: 2A00     Brain cancer Click to Show/Hide
The Studied Tissue     Nervous tissue
The Specified Disease     Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.33E-06; Fold-change: -0.111824285; Z-score: -0.296907042
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Brain stem tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.79783405; Fold-change: -0.014146193; Z-score: -0.034045816
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     White matter tissue
The Specified Disease     Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.004025376; Fold-change: 0.896873182; Z-score: 1.413033115
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Brain stem tissue
The Specified Disease     Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.085888939; Fold-change: -0.112305144; Z-score: -0.861885004
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A20     Myeloproliferative neoplasm Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.648498263; Fold-change: -0.019119513; Z-score: -0.110155719
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.383441619; Fold-change: 0.003227897; Z-score: 0.016711368
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A36     Myelodysplastic syndrome Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.006208382; Fold-change: 0.114574752; Z-score: 0.433755338
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.022646216; Fold-change: -2.526067519; Z-score: -2.195443355
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A81     Diffuse large B-cell lymphoma Click to Show/Hide
The Studied Tissue     Tonsil tissue
The Specified Disease     Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.516019168; Fold-change: -0.077918271; Z-score: -0.30986419
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2A83     Plasma cell neoplasm Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.017855745; Fold-change: -0.189433373; Z-score: -0.930840128
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Peripheral blood
The Specified Disease     Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.632657658; Fold-change: -0.267273587; Z-score: -0.148206204
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B33     Leukaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.05E-13; Fold-change: -0.518540546; Z-score: -1.188787112
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B6E     Oral cancer Click to Show/Hide
The Studied Tissue     Oral tissue
The Specified Disease     Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.831611064; Fold-change: 0.124127745; Z-score: 0.091270569
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 8.56E-10; Fold-change: 0.325624852; Z-score: 0.641500129
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B70     Esophageal cancer Click to Show/Hide
The Studied Tissue     Esophagus
The Specified Disease     Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.003564355; Fold-change: 0.428263037; Z-score: 1.173233672
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B72     Stomach cancer Click to Show/Hide
The Studied Tissue     Gastric tissue
The Specified Disease     Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.009950708; Fold-change: 1.816577543; Z-score: 4.953977401
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.005354266; Fold-change: 1.206842557; Z-score: 1.069292835
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B90     Colon cancer Click to Show/Hide
The Studied Tissue     Colon tissue
The Specified Disease     Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.04E-29; Fold-change: -0.825251067; Z-score: -1.321874328
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 4.87E-18; Fold-change: -0.78940728; Z-score: -1.116415491
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2B92     Rectal cancer Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001195845; Fold-change: -0.999682456; Z-score: -2.336436281
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 4.49E-05; Fold-change: -1.394839757; Z-score: -3.513746292
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C10     Pancreatic cancer Click to Show/Hide
The Studied Tissue     Pancreas
The Specified Disease     Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001479148; Fold-change: 0.367001034; Z-score: 0.798093527
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.186755837; Fold-change: 0.366353747; Z-score: 0.264560521
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C12     Liver cancer Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.163855739; Fold-change: 0.192456355; Z-score: 0.290960311
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.021671418; Fold-change: 0.124004362; Z-score: 0.230506273
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 0.322824761; Fold-change: -0.013821108; Z-score: -0.0641191
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C25     Lung cancer Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.855324566; Fold-change: -0.107679551; Z-score: -0.184647631
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.000795428; Fold-change: 0.129674284; Z-score: 0.214427235
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C30     Skin cancer Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.671727698; Fold-change: 0.127431396; Z-score: 0.093019744
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Skin
The Specified Disease     Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.68E-49; Fold-change: -1.513677006; Z-score: -1.833313858
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 6.21E-18; Fold-change: -1.236418733; Z-score: -1.173237708
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C6Z     Breast cancer Click to Show/Hide
The Studied Tissue     Breast tissue
The Specified Disease     Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 9.94E-36; Fold-change: -0.788626349; Z-score: -1.074492417
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 1.36E-08; Fold-change: -0.784586289; Z-score: -0.94967168
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C73     Ovarian cancer Click to Show/Hide
The Studied Tissue     Ovarian tissue
The Specified Disease     Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.195259647; Fold-change: -0.600803542; Z-score: -1.101263566
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.000135398; Fold-change: -2.663943993; Z-score: -2.006521133
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C77     Cervical cancer Click to Show/Hide
The Studied Tissue     Cervical tissue
The Specified Disease     Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000561992; Fold-change: -0.661723782; Z-score: -1.254800478
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C78     Uterine cancer Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.014151279; Fold-change: 0.021809131; Z-score: 0.016480696
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.113001522; Fold-change: -0.990655124; Z-score: -0.724385089
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C82     Prostate cancer Click to Show/Hide
The Studied Tissue     Prostate
The Specified Disease     Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.364700568; Fold-change: -0.540796862; Z-score: -0.354537371
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C90     Renal cancer Click to Show/Hide
The Studied Tissue     Kidney
The Specified Disease     Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.629067347; Fold-change: 0.13463859; Z-score: 0.139646288
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 3.53E-11; Fold-change: -0.672339793; Z-score: -0.782997258
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C92     Ureter cancer Click to Show/Hide
The Studied Tissue     Urothelium
The Specified Disease     Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.196608426; Fold-change: -0.104112436; Z-score: -0.600351539
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2C94     Bladder cancer Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.216541034; Fold-change: 0.046496558; Z-score: 0.137639776
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D02     Retinal cancer Click to Show/Hide
The Studied Tissue     Uvea
The Specified Disease     Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.061658564; Fold-change: 0.294945996; Z-score: 1.861360073
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D10     Thyroid cancer Click to Show/Hide
The Studied Tissue     Thyroid
The Specified Disease     Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.17E-77; Fold-change: 3.352868407; Z-score: 5.030265371
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 5.26E-23; Fold-change: 3.2050062; Z-score: 3.129947527
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D11     Adrenal cancer Click to Show/Hide
The Studied Tissue     Adrenal cortex
The Specified Disease     Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 0.0118503; Fold-change: 0.089929919; Z-score: 0.23548748
Target expression in the diseased tissue of patients
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D12     Endocrine gland neoplasm Click to Show/Hide
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000114929; Fold-change: 0.259844674; Z-score: 2.013090028
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Pituitary tissue
The Specified Disease     Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.041970313; Fold-change: 0.01106594; Z-score: 0.105730503
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 2D42     Head and neck cancer Click to Show/Hide
The Studied Tissue     Head and neck tissue
The Specified Disease     Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 6.74E-06; Fold-change: 0.346522412; Z-score: 0.630121185
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 03 Disease of the blood or blood-forming organs Click to Show/Hide
                  ICD-11: 3A51     Sickle cell disorder Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 4.96E-06; Fold-change: -0.84426096; Z-score: -2.683643991
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3A70     Aplastic anaemia Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.591739452; Fold-change: 0.417126532; Z-score: 0.825891607
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3B63     Thrombocytosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.556870811; Fold-change: -0.069954622; Z-score: -0.429425316
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 3B64     Thrombocytopenia Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.392862558; Fold-change: -0.417650979; Z-score: -0.354639113
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 04 Disease of the immune system Click to Show/Hide
                  ICD-11: 4A00     Immunodeficiency Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.34552013; Fold-change: -0.098392646; Z-score: -0.620522822
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A40     Lupus erythematosus Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.112657315; Fold-change: -0.076677864; Z-score: -0.082726961
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A42     Systemic sclerosis Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.3679092; Fold-change: -0.012974315; Z-score: -0.034341841
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A43     Systemic autoimmune disease Click to Show/Hide
The Studied Tissue     Salivary gland tissue
The Specified Disease     Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.494287252; Fold-change: -0.898009303; Z-score: -0.783335438
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.951537992; Fold-change: -0.208842129; Z-score: -0.342793854
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4A62     Behcet disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.526492231; Fold-change: -0.01888861; Z-score: -0.041046968
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 4B04     Monocyte count disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.228849739; Fold-change: -0.372768948; Z-score: -0.819822804
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 05 Endocrine, nutritional or metabolic disease Click to Show/Hide
                  ICD-11: 5A11     Type 2 diabetes mellitus Click to Show/Hide
The Studied Tissue     Omental adipose tissue
The Specified Disease     Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.297729619; Fold-change: -0.229135771; Z-score: -0.313623711
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Liver tissue
The Specified Disease     Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.953546822; Fold-change: -0.273953493; Z-score: -1.84855085
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5A80     Ovarian dysfunction Click to Show/Hide
The Studied Tissue     Vastus lateralis muscle
The Specified Disease     Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.207527439; Fold-change: 0.091126261; Z-score: 0.544366852
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5B81     Obesity Click to Show/Hide
The Studied Tissue     Subcutaneous adipose tissue
The Specified Disease     Obesity [ICD-11:5B81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.645096803; Fold-change: -0.304548057; Z-score: -0.435159937
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C51     Inborn carbohydrate metabolism disorder Click to Show/Hide
The Studied Tissue     Biceps muscle
The Specified Disease     Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.328094826; Fold-change: 0.65352732; Z-score: 1.510209148
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C56     Lysosomal disease Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.206356057; Fold-change: -0.098513735; Z-score: -0.280567327
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 5C80     Hyperlipoproteinaemia Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.099831001; Fold-change: 0.103182203; Z-score: 0.558464737
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.62E-08; Fold-change: -1.221212568; Z-score: -2.016764494
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 06 Mental, behavioural or neurodevelopmental disorder Click to Show/Hide
                  ICD-11: 6A02     Autism spectrum disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.003147925; Fold-change: -0.191502654; Z-score: -0.58036859
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 6A20     Schizophrenia Click to Show/Hide
The Studied Tissue     Superior temporal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.844664502; Fold-change: -0.042499372; Z-score: -0.356362553
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Prefrontal cortex
The Specified Disease     Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.231664239; Fold-change: 0.013815221; Z-score: 0.012277515
                  ICD-11: 6A60     Bipolar disorder Click to Show/Hide
The Studied Tissue     Prefrontal cortex
The Specified Disease     Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.20223026; Fold-change: 0.019737131; Z-score: 0.048519731
                  ICD-11: 6A70     Depressive disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.014198199; Fold-change: -0.118386567; Z-score: -0.432288875
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Prefrontal cortex
The Specified Disease     Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.268503292; Fold-change: 0.015550577; Z-score: 0.037656156
      ICD Disease Classification 08 Disease of the nervous system Click to Show/Hide
                  ICD-11: 8A00     Parkinsonism Click to Show/Hide
The Studied Tissue     Substantia nigra tissue
The Specified Disease     Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.27088121; Fold-change: -0.113777465; Z-score: -1.120720467
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A01     Choreiform disorder Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.528558418; Fold-change: 0.309149738; Z-score: 0.93513275
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A20     Alzheimer disease Click to Show/Hide
The Studied Tissue     Entorhinal cortex
The Specified Disease     Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.482531956; Fold-change: -0.092373854; Z-score: -0.295712085
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A2Y     Neurocognitive impairment Click to Show/Hide
The Studied Tissue     White matter tissue
The Specified Disease     HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.04709479; Fold-change: -0.11329848; Z-score: -0.570607911
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A40     Multiple sclerosis Click to Show/Hide
The Studied Tissue     Plasmacytoid dendritic cells
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.950636514; Fold-change: -0.017507183; Z-score: -0.068443054
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Spinal cord
The Specified Disease     Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.351563021; Fold-change: -0.173332988; Z-score: -0.569476865
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8A60     Epilepsy Click to Show/Hide
The Studied Tissue     Peritumoral cortex tissue
The Specified Disease     Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section     p-value: 0.314802894; Fold-change: 0.09387929; Z-score: 0.802989788
Target expression in the diseased tissue of patients
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Whole blood
The Specified Disease     Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.139835788; Fold-change: -0.270091813; Z-score: -0.487164031
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B01     Subarachnoid haemorrhage Click to Show/Hide
The Studied Tissue     Intracranial artery
The Specified Disease     Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.531867274; Fold-change: -0.123171495; Z-score: -0.184130462
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B11     Cerebral ischaemic stroke Click to Show/Hide
The Studied Tissue     Whole blood
The Specified Disease     Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 2.76E-07; Fold-change: -0.767465527; Z-score: -1.783412971
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Peripheral blood
The Specified Disease     Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.426473931; Fold-change: 0.040120854; Z-score: 0.082636927
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8B60     Motor neuron disease Click to Show/Hide
The Studied Tissue     Cervical spinal cord
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.892630374; Fold-change: 0.012756446; Z-score: 0.085094035
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Skin
The Specified Disease     Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.677625226; Fold-change: -0.13604604; Z-score: -0.201814917
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8C70     Muscular dystrophy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.285938076; Fold-change: 0.194707292; Z-score: 0.321144059
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: 8C75     Distal myopathy Click to Show/Hide
The Studied Tissue     Muscle tissue
The Specified Disease     Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 3.45E-09; Fold-change: 1.681950221; Z-score: 3.319107966
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 09 Disease of the visual system Click to Show/Hide
                  ICD-11: 9A96     Anterior uveitis Click to Show/Hide
The Studied Tissue     Peripheral monocyte
The Specified Disease     Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.399884927; Fold-change: -0.157493127; Z-score: -0.909354033
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 11 Disease of the circulatory system Click to Show/Hide
                  ICD-11: BA00     Essential hypertension Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Essential hypertension [ICD-11:BA00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.513059087; Fold-change: -0.173448616; Z-score: -0.955235945
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BA41     Myocardial infarction Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001393469; Fold-change: -1.365376691; Z-score: -1.072109694
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BA80     Coronary artery disease Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.158627726; Fold-change: -0.383503555; Z-score: -1.036914362
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: BB70     Aortic valve stenosis Click to Show/Hide
The Studied Tissue     Calcified aortic valve
The Specified Disease     Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.061889567; Fold-change: 0.368922544; Z-score: 0.904451387
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 12 Disease of the respiratory system Click to Show/Hide
                  ICD-11: 7A40     Central sleep apnoea Click to Show/Hide
The Studied Tissue     Hyperplastic tonsil
The Specified Disease     Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.652357657; Fold-change: -0.066713137; Z-score: -0.256812707
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA08     Vasomotor or allergic rhinitis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.350741143; Fold-change: 0.492748529; Z-score: 0.953641247
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA0A     Chronic rhinosinusitis Click to Show/Hide
The Studied Tissue     Sinus mucosa tissue
The Specified Disease     Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.550375843; Fold-change: -0.289627955; Z-score: -1.095297101
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA22     Chronic obstructive pulmonary disease Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.188507504; Fold-change: 0.137457317; Z-score: 0.258003538
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Small airway epithelium
The Specified Disease     Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.669332971; Fold-change: -0.08996133; Z-score: -0.114828039
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CA23     Asthma Click to Show/Hide
The Studied Tissue     Nasal and bronchial airway
The Specified Disease     Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001266679; Fold-change: -0.552760194; Z-score: -0.468276099
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: CB03     Idiopathic interstitial pneumonitis Click to Show/Hide
The Studied Tissue     Lung tissue
The Specified Disease     Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.079076563; Fold-change: 0.618800147; Z-score: 1.089557223
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 13 Disease of the digestive system Click to Show/Hide
                  ICD-11: DA0C     Periodontal disease Click to Show/Hide
The Studied Tissue     Gingival tissue
The Specified Disease     Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.01207453; Fold-change: -0.129733923; Z-score: -0.234334943
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DA42     Gastritis Click to Show/Hide
The Studied Tissue     Gastric antrum tissue
The Specified Disease     Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.021900727; Fold-change: -1.610099627; Z-score: -5.302929278
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DB92     Non-alcoholic fatty liver disease Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Non alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.090875793; Fold-change: 0.21132903; Z-score: 0.302415863
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DB99     Hepatic failure Click to Show/Hide
The Studied Tissue     Liver tissue
The Specified Disease     Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.007276155; Fold-change: -1.39854094; Z-score: -2.990624537
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DD71     Ulcerative colitis Click to Show/Hide
The Studied Tissue     Colon mucosal tissue
The Specified Disease     Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 0.527448157; Fold-change: -0.217082026; Z-score: -0.594346158
Target expression in the diseased tissue of patients
Target expression in tissue other than the diseased tissue of patients
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: DD91     Irritable bowel syndrome Click to Show/Hide
The Studied Tissue     Rectal colon tissue
The Specified Disease     Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.349332523; Fold-change: 0.045559244; Z-score: 0.118860136
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 14 Disease of the skin Click to Show/Hide
                  ICD-11: EA80     Atopic eczema Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000449937; Fold-change: -0.75783214; Z-score: -1.624084767
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: EA90     Psoriasis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.053997459; Fold-change: 0.008701737; Z-score: 0.011954948
The Expression Level of Disease Section Compare with the Adjacent Tissue     p-value: 6.42E-08; Fold-change: 0.679564239; Z-score: 0.80509135
Target expression in the diseased tissue of patients
Target expression in the normal tissue adjacent to the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: ED63     Acquired hypomelanotic disorder Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.872052686; Fold-change: 0.056796428; Z-score: 0.089188723
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: ED70     Alopecia or hair loss Click to Show/Hide
The Studied Tissue     Skin from scalp
The Specified Disease     Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.954493001; Fold-change: -0.021127002; Z-score: -0.05396592
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: EK0Z     Contact dermatitis Click to Show/Hide
The Studied Tissue     Skin
The Specified Disease     Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.843632465; Fold-change: -0.000784626; Z-score: -0.002327916
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 15 Disease of the musculoskeletal system/connective tissue Click to Show/Hide
                  ICD-11: FA00     Osteoarthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.032582067; Fold-change: -0.297762736; Z-score: -1.001345817
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
The Studied Tissue     Synovial tissue
The Specified Disease     Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.947638355; Fold-change: -0.015591195; Z-score: -0.039377733
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA20     Rheumatoid arthritis Click to Show/Hide
The Studied Tissue     Synovial tissue
The Specified Disease     Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 1.56E-05; Fold-change: 0.679596648; Z-score: 1.382796433
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA24     Juvenile idiopathic arthritis Click to Show/Hide
The Studied Tissue     Peripheral blood
The Specified Disease     Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.001041115; Fold-change: -0.124915984; Z-score: -0.302246492
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FA92     Inflammatory spondyloarthritis Click to Show/Hide
The Studied Tissue     Pheripheral blood
The Specified Disease     Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.411171818; Fold-change: 0.164306238; Z-score: 0.585296227
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: FB83     Low bone mass disorder Click to Show/Hide
The Studied Tissue     Bone marrow
The Specified Disease     Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.341145638; Fold-change: -0.497659997; Z-score: -0.6682566
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 16 Disease of the genitourinary system Click to Show/Hide
                  ICD-11: GA10     Endometriosis Click to Show/Hide
The Studied Tissue     Endometrium tissue
The Specified Disease     Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.000104958; Fold-change: 1.543988012; Z-score: 1.353437699
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: GC00     Cystitis Click to Show/Hide
The Studied Tissue     Bladder tissue
The Specified Disease     Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.002148359; Fold-change: 1.000201911; Z-score: 2.30443521
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 19 Certain condition originating in the perinatal period Click to Show/Hide
                  ICD-11: KA21     Short gestation disorder Click to Show/Hide
The Studied Tissue     Myometrium
The Specified Disease     Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.425383189; Fold-change: 0.076622871; Z-score: 0.217357568
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
      ICD Disease Classification 20 Developmental anomaly Click to Show/Hide
                  ICD-11: LD2C     Overgrowth syndrome Click to Show/Hide
The Studied Tissue     Adipose tissue
The Specified Disease     Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.54803223; Fold-change: -0.143403057; Z-score: -0.280038278
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
                  ICD-11: LD2D     Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide
The Studied Tissue     Perituberal tissue
The Specified Disease     Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue     p-value: 0.786890876; Fold-change: -0.064714072; Z-score: -0.158176099
Target expression in the diseased tissue of patients
Target expression in the normal tissue of healthy individuals
Boxplot of Target Disease-specific Protein Abundances Click to View the Clearer Original Diagram
References
1 In-vitro renal epithelial cell infection reveals a viral kidney tropism as a potential mechanism for acute renal failure during Middle East Respira... Virol J. 2013 Dec 23;10:359.
2 ClinicalTrials.gov (NCT04371978) Efficacy and Safety of Dipeptidyl Peptidase-4 Inhibitors in Diabetic Patients With Established COVID-19. U.S. National Institutes of Health.
3 Coronaviruses - drug discovery and therapeutic options. Nat Rev Drug Discov. 2016 May;15(5):327-47.
4 Inhibition of Middle East respiratory syndrome coronavirus infection by anti-CD26 monoclonal antibody. J Virol. 2013 Dec;87(24):13892-9.
5 DPP4 inhibition: preventing SARS-CoV-2 infection and/or progression of COVID-19 Diabetes Metab Res Rev. 2020 Apr 26.
6 Effects of Dipeptidyl Peptidase 4 Inhibition on Inflammation in Atherosclerosis: A 18 F-fluorodeoxyglucose Study of a Mouse Model of Atherosclerosis and Type 2 DiabetesAtherosclerosis. 2020 Apr 10. pii: S0021-9150(20)30194-5.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.