| Drug General Information |
| Drug ID |
D09LEP
|
| Drug Name |
Pyrethroids |
|
| Synonyms |
resmethrin; 10453-86-8; Benzofuroline; For-syn; Penncapthrin; Resmethrine; Benzyfuroline; Isathrine; Enforcer; Chryson; Synthrin; Pyresthrin; Premgard; Crossfire; Chrysron; Resmethrin [ANSI]; Resbuthrin; Caswell No. 083E; Bioresmethrine; SB Pennick 1382; Penick 1382; Resmetrina [Portuguese]; ARI-B; Resmethrine [ISO-French]; S.B. Penick 1382; d-trans-Resmethrin; 5-Benzylfurfuryl chrysanthemate; NRDC 104; Bioresmethrin (d trans isomer); CCRIS 2501; HSDB 1516; SBP-1382; OMS-1206; EINECS 233-940-7; FMC 17370; ENT 27474; NIA 17370 |
| Drug Type |
Small molecular drug |
| Structure |
|
| Drug Resistance Mutations |
| Target Name |
Tetranychus urticae Voltage-gated sodium channel (VGSC) |
Target Info |
| Gene Name |
VGSC |
| Uniprot ID |
C5HA89_TETUR |
| Species |
Tetranychus urticae |
| Reference Sequence |
IGRVLRLVKGARGIRTLLFALAMSLPALFNICLLLFLVMFIYAIFGMSFFMNVKQRYGLD
[Tetranychus urticae]
|
| Drug Resistance Mutations |
| Mutation info |
Missense: A1215D |
[1] |
|
| Mutation info |
Missense: F1538I |
[1] |
|
| Mutation info |
Missense: L1024V |
[1] |
|
| References |
| REF 1 |
Global distribution and origin of target site insecticide resistance mutations in Tetranychus urticae.Insect Biochem Mol Biol.2014 May;48:17-28.
|
