Target General Information
Target ID T60366 Target Info
Target Name Ornithine decarboxylase (ODC1)
Synonyms ODC
Target Type Successful Target
Gene Name ODC1
Biochemical Class Carbon-carbon lyase
UniProt ID
The Transcription Factors (TFs) Regulating This Target
TF Name c-Myc proto-oncogene (MYC)
Classification Superclass Basic Domains
Class Helix-loop-helix / leucine zipper factors (bHLH-ZIP)
Family Cell-cycle controlling factors
Subfamily Myc
Regulation Mechanism C-Myc is a potent transactivator of ODC promoter-reporter gene constructs in fibroblasts that requires the CACGTG repeat. [1]
Evidence Score (E-score) 2 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [1]
2 Chromatin Immunoprecipitation Assay [2]
UniProt ID
Sequence
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Eukaryotic initiation factors [+] 1 Eukaryotic initiation factors Co-regulated By This TF +
1 Eukaryotic initiation factor 4E (EIF4E) Literature-reported Target Target Info [3]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 C-X-C chemokine receptor type 4 (CXCR4) Successful Target Target Info [4]
Kinases [+] 2 Kinases Co-regulated By This TF +
1 Erbb2 tyrosine kinase receptor (HER2) Successful Target Target Info [5]
2 Telomerase reverse transcriptase (TERT) Clinical trial Target Target Info [6]
Lyases [+] 1 Lyases Co-regulated By This TF +
1 Ornithine decarboxylase (ODC1) Successful Target Target Info [1]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Transcription factor E2F2 (E2F2) Literature-reported Target Target Info [7]
TF Name Myc-associated factor X (MAX) homodimer
Classification Superclass Basic Domains
Class Helix-loop-helix / leucine zipper factors (bHLH-ZIP)
Family Cell-cycle controlling factors
Subfamily Mad/Max
Regulation Mechanism MAX is a potent transactivator of ODC promoter-reporter gene constructs in fibroblasts that requires the CACGTG repeat. [1]
Evidence Score (E-score) 1 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
Sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Lyases [+] 1 Lyases Co-regulated By This TF +
1 Ornithine decarboxylase (ODC1) Successful Target Target Info [1]
References
REF 1 The ornithine decarboxylase gene is a transcriptional target of c-Myc. Proc Natl Acad Sci U S A. 1993 Aug 15;90(16):7804-8.
REF 2 Associations of a polymorphism in the ornithine decarboxylase gene with colorectal cancer survival. Clin Cancer Res. 2009 Oct 1;15(19):6208-16.
REF 3 An essential E box in the promoter of the gene encoding the mRNA cap-binding protein (eukaryotic initiation factor 4E) is a target for activation by c-myc. Mol Cell Biol. 1996 Sep;16(9):4754-64.
REF 4 USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92.
REF 5 c-myc reverses neu-induced transformed morphology by transcriptional repression. Mol Cell Biol. 1991 Jan;11(1):354-62.
REF 6 Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77.
REF 7 Identification of positively and negatively acting elements regulating expression of the E2F2 gene in response to cell growth signals. Mol Cell Biol. 1997 Sep;17(9):5227-35.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.