Target General Information
Target ID T66426 Target Info
Target Name Hematopoietic progenitor cell antigen CD34 (CD34)
Synonyms CD34 molecule
Target Type Clinical trial Target
Gene Name CD34
UniProt ID
The Transcription Factors (TFs) Regulating This Target
TF Name Myeloid zinc finger 1 (MZF1) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys2His2 zinc finger domain
Family Developmental / cell cycle regulators
Subfamily Krueppel-like
Regulation Mechanism MZF1 expression are driven by the CD34 or c-myb 5'-flanking region. MZF1 plays a critical role in hematopoiesis by modulating the expression of CD34 promoter. [1]
Evidence Score (E-score) 2 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [1]
2 Electrophoretic Mobility Shift Assay [2]
UniProt ID
Sequence
MRPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFRYEEATGPQE
ALAQLRELCRQWLRPEVRSKEQMLELLVLEQFLGALPPEIQARVQGQRPGSPEEAAALVD
GLRREPGGPRRWVTVQVQGQEVLSEKMEPSSFQPLPETEPPTPEPGPKTPPRTMQESPLG
LQVKEESEVTEDSDFLESGPLAATQESVPTLLPEEAQRCGTVLDQIFPHSKTGPEGPSWR
EHPRALWHEEAGGIFSPGFALQLGSISAGPGSVSPHLHVPWDLGMAGLSGQIQSPSREGG
FAHALLLPSDLRSEQDPTDEDPCRGVGPALITTRWRSPRGRSRGRPSTGGGVVRGGRCDV
CGKVFSQRSNLLRHQKIHTGERPFVCSECGRSFSRSSHLLRHQLTHTEERPFVCGDCGQG
FVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPE
PPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVECGERFGRRSVLLQHRRVHSGERP
FACAECGQSFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKPFACP
ECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQ
SFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQ
STKLIQHQRVHSAE
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
CD antigens [+] 1 CD antigens Co-regulated By This TF +
1 Hematopoietic progenitor cell antigen CD34 (CD34) Clinical trial Target Target Info [1]
References
REF 1 Overexpression of the zinc finger protein MZF1 inhibits hematopoietic development from embryonic stem cells: correlation with negative regulation of CD34 and c-myb promoter activity. Mol Cell Biol. 1995 Nov;15(11):6075-87.
REF 2 The myeloid zinc finger gene, MZF-1, regulates the CD34 promoter in vitro. Blood. 1995 Nov 15;86(10):3640-7.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.