Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T06850
(Former ID: TTDR00583)
|
|||||
Target Name |
Ghrelin (GHRL)
|
|||||
Synonyms |
UNQ524/PRO1066; Motilin-related peptide; M46 protein; Growth hormone secretagogue; Growth hormone releasing peptide; Gastric peptide ghrelin; GHRL
|
|||||
Gene Name |
GHRL
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Diabetes mellitus [ICD-11: 5A10] | |||||
Function |
Specific ligand for the growth hormone secretagogue receptor type 1 (ghsr) inducing the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion.Involved in growth regulation.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | Unacylated ghrelin | Drug Info | Phase 1 | Type-1 diabetes | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | Unacylated ghrelin | Drug Info | [3] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | cAMP signaling pathway |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 2 | Alize Pharma announces positive results for AZP-531, its unacylated ghrelin analog, from two Phase I clinical trials in healthy volunteers and obese subjects. Lyon, France, December 10, 2014. | |||||
REF 3 | Alize Pharma signs research collaboration and license option agreement with Lilly. Lyon, France, January 25, 2010. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.