Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T06850
(Former ID: TTDR00583)
|
|||||
| Target Name |
Ghrelin (GHRL)
|
|||||
| Synonyms |
UNQ524/PRO1066; Motilin-related peptide; M46 protein; Growth hormone secretagogue; Growth hormone releasing peptide; Gastric peptide ghrelin; GHRL
|
|||||
| Gene Name |
GHRL
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Diabetes mellitus [ICD-11: 5A10] | |||||
| Function |
Specific ligand for the growth hormone secretagogue receptor type 1 (ghsr) inducing the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion.Involved in growth regulation.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Unacylated ghrelin | Drug Info | Phase 1 | Type-1 diabetes | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | Unacylated ghrelin | Drug Info | [3] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | cAMP signaling pathway | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 2 | Alize Pharma announces positive results for AZP-531, its unacylated ghrelin analog, from two Phase I clinical trials in healthy volunteers and obese subjects. Lyon, France, December 10, 2014. | |||||
| REF 3 | Alize Pharma signs research collaboration and license option agreement with Lilly. Lyon, France, January 25, 2010. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.