Target General Infomation
Target ID
T14853 (Former ID: TTDI02072)
Target Name
Fibroblast growth factor-23 (FGF23)
Synonyms
Tumor-derived hypophosphatemia-inducing factor; Phosphatonin; HYPF; Fibroblast growth factor 23; FGF-23
Gene Name
FGF23
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Vitamin/non-protein cofactor absorption/transport disorder [ICD-11: 5C63]
Function
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid to decrease PTH secretion (By similarity). Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.
BioChemical Class
Growth factor
UniProt ID
FGF23_HUMAN
Sequence
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Burosumab Drug Info Approved X-linked hypophosphataemia [1]
Mode of Action [+] 1 Modes of Action +
Modulator [+] 1 Modulator drugs +
1 Burosumab Drug Info [1]
References
REF 1 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.