Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T16340
(Former ID: TTDI01935)
|
|||||
Target Name |
Interleukin-1 alpha (IL1A)
|
|||||
Synonyms |
IL1F1; IL-1 alpha; Hematopoietin-1
|
|||||
Gene Name |
IL1A
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Colorectal cancer [ICD-11: 2B91] | |||||
2 | Influenza [ICD-11: 1E30-1E32] | |||||
Function |
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Click to Show/Hide
|
|||||
BioChemical Class |
Cytokine: interleukin
|
|||||
UniProt ID | ||||||
Sequence |
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP NLFIATKQDYWVCLAGGPPSITDFQILENQA Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
1 | MABp1 | Drug Info | Phase 3 | Colorectal cancer | [2] | |
2 | Xilonix | Drug Info | Phase 3 | Influenza virus infection | [3] | |
3 | ABT-981 | Drug Info | Phase 2 | Osteoarthritis | [4], [5] | |
Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
1 | IX207-887 | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [6] | |
2 | IL1aQb | Drug Info | Terminated | Arteriosclerosis | [7] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | MABp1 | Drug Info | [8] | |||
Modulator | [+] 4 Modulator drugs | + | ||||
1 | Xilonix | Drug Info | [9] | |||
2 | ABT-981 | Drug Info | [1] | |||
3 | IX207-887 | Drug Info | [10], [11] | |||
4 | Interleukin-1-alpha - Amgen/Roche | Drug Info | [13] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Generation and characterization of ABT-981, a dual variable domain immunoglobulin (DVD-Ig(TM)) molecule that specifically and potently neutralizes both IL-1alpha and IL-1beta. MAbs. 2015;7(3):605-19. | |||||
REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 3 | Clinical pipeline report, company report or official report of Xbiotech. | |||||
REF 4 | ClinicalTrials.gov (NCT02087904) A Phase 2a Study Evaluating the Safety, Efficacy, and Pharmacodynamic Effects of ABT-981 in Patients With Knee Osteoarthritis | |||||
REF 5 | ClinicalTrials.gov (NCT02384538) A Phase 2a Study Evaluating the Safety and Efficacy of ABT-981 in Patients With Erosive Hand Osteoarthritis | |||||
REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002363) | |||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021743) | |||||
REF 8 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 9 | Clinical pipeline report, company report or official report of xbiotech. | |||||
REF 10 | Inhibition of interleukin-1 release by IX 207-887. Agents Actions. 1990 Jun;30(3-4):350-62. | |||||
REF 11 | Modulation of secretory processes of phagocytes by IX 207-887. Springer Semin Immunopathol. 1993;14(4):345-52. | |||||
REF 12 | Cytos Biotechnology AG - Product Pipeline Review - 2013. Global Markets Direct. Dec 2013. | |||||
REF 13 | Identification of regions in interleukin-1 alpha important for activity. J Biol Chem. 1993 Oct 15;268(29):22105-11. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.