Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T17448
(Former ID: TTDS00089)
|
|||||
| Target Name |
Histamine N-methyltransferase (HNMT)
|
|||||
| Synonyms |
Histamine-N-methyltransferase; HNMT; HMT
|
|||||
| Gene Name |
HNMT
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Episodic vestibular syndrome [ICD-11: AB31] | |||||
| 2 | Malaria [ICD-11: 1F40-1F45] | |||||
| Function |
Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine.
|
|||||
| BioChemical Class |
Methyltransferase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 2.1.1.8
|
|||||
| Sequence |
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIG
GGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETS SEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWD KLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLL WDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA |
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | Amodiaquine | Drug Info | Approved | Malaria | [2] | |
| 2 | Diphenhydramine | Drug Info | Approved | Meniere disease | [3] | |
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | Metoprine | Drug Info | Phase 2 | Advanced cancer | [4], [5] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 5 Inhibitor drugs | + | ||||
| 1 | Amodiaquine | Drug Info | [1] | |||
| 2 | Diphenhydramine | Drug Info | [6] | |||
| 3 | Metoprine | Drug Info | [6] | |||
| 4 | (L-)-S-adenosyl-L-homocysteine | Drug Info | [7] | |||
| 5 | 4-(DIMETHYLAMINO)BUTYL IMIDOTHIOCARBAMATE | Drug Info | [6] | |||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| BioCyc | [+] 1 BioCyc Pathways | + | ||||
| 1 | Histamine degradation | |||||
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Histidine metabolism | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | TGF_beta_Receptor Signaling Pathway | |||||
| Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
| 1 | Histidine Metabolism | |||||
| WikiPathways | [+] 2 WikiPathways | + | ||||
| 1 | Methylation Pathways | |||||
| 2 | Metapathway biotransformation | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Effect of amodiaquine, a histamine N-methyltransferase inhibitor, on, Propionibacterium acnes and lipopolysaccharide-induced hepatitis in mice. Eur J Pharmacol. 2007 Mar 8;558(1-3):179-84. | |||||
| REF 2 | Drug information of Amodiaquine, 2008. eduDrugs. | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7412). | |||||
| REF 5 | ClinicalTrials.gov (NCT01579110) Efficacy and Safety of Levamisole Combined With Standard Prednisolone in Warm Antibody Autoimmune Hemolytic Anemia.. U.S. National Institutes of Health. | |||||
| REF 6 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 7 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.