Target General Infomation
Target ID
T31956 (Former ID: TTDR00531)
Target Name
Glutamyl aminopeptidase (ENPEP)
Synonyms
ENPEP; EAP; Differentiation antigen gp160; Aminopeptidase A; APA
Gene Name
ENPEP
Target Type
Clinical trial target
[1]
Disease [+] 1 Target-related Diseases +
1 Hypertension [ICD-11: BA00-BA04]
Function
Appears to have a role in the catabolicpathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells.
BioChemical Class
Peptidase
UniProt ID
AMPE_HUMAN
EC Number
EC 3.4.11.7
Sequence
MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 1 Clinical Trial Drugs +
1 QGC-001 Drug Info Phase 2 Hypertension [2]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 4 Inhibitor drugs +
1 QGC-001 Drug Info [1]
2 EC33 Drug Info [3]
3 KELATORPHAN Drug Info [4]
4 PMID10602705C40 Drug Info [5]
Target Affiliated Biological Pathways
KEGG Pathway [+] 1 KEGG Pathways +
1 Renin-angiotensin system
NetPath Pathway [+] 1 NetPath Pathways +
1 IL2 Signaling Pathway
Reactome [+] 1 Reactome Pathways +
1 Metabolism of Angiotensinogen to Angiotensins
WikiPathways [+] 1 WikiPathways +
1 Metabolism of Angiotensinogen to Angiotensins
Target-Related Models and Studies
Target Validation
References
REF 1 Clinical pipeline report, company report or official report of Quantum Genomics.
REF 2 ClinicalTrials.gov (NCT02322450) Phase IIa Study of the Product QGC001 Compared With Placebo in Patients With Essential Hypertension. U.S. National Institutes of Health.
REF 3 Aminopeptidase A, which generates one of the main effector peptides of the brain renin-angiotensin system, angiotensin III, has a key role in central control of arterial blood pressure. Biochem Soc Trans. 2000;28(4):435-40.
REF 4 Retro-inverso concept applied to the complete inhibitors of enkephalin-degrading enzymes. J Med Chem. 1988 Sep;31(9):1825-31.
REF 5 Investigation of subsite preferences in aminopeptidase A (EC 3.4.11.7) led to the design of the first highly potent and selective inhibitors of this enzyme. J Med Chem. 1999 Dec 16;42(25):5197-211.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.