Target General Infomation
Target ID
T34389
Target Name
Fatty-acid amide hydrolase 1 (FAAH1)
Synonyms
Oleamide hydrolase 1 of mouse; Oleamide hydrolase 1; FAAH; Anandamide amidohydrolase 1 of mouse; Anandamide amidohydrolase 1
Gene Name
FAAH1
Target Type
Patented-recorded target
[1]
Function
Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates. Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules.
BioChemical Class
Carbon-nitrogen hydrolase
UniProt ID
FAAH1_HUMAN
EC Number
EC 3.5.1.99
Sequence
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 10 Inhibitor drugs +
1 Carbamate derivative 2 Drug Info [1]
2 Carbamate derivative 4 Drug Info [1]
3 Carbamate derivative 5 Drug Info [1]
4 Carbamate derivative 6 Drug Info [1]
5 Carbamide derivative 1 Drug Info [1]
6 Carbamoyl oxime derivative 1 Drug Info [1]
7 Ethylaminopyrimidine derivative 1 Drug Info [1]
8 Piperazine urea derivative 2 Drug Info [1]
9 PMID26413912-Compound-84 Drug Info [1]
10 Pyrimidinyl ethylenediamine derivative 1 Drug Info [1]
Target Affiliated Biological Pathways
KEGG Pathway [+] 1 KEGG Pathways +
1 Retrograde endocannabinoid signaling
References
REF 1 Fatty acid amide hydrolase inhibitors: a patent review (2009-2014).Expert Opin Ther Pat. 2015;25(11):1247-66.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.