Target General Infomation
Target ID
T60433 (Former ID: TTDS00472)
Target Name
T-cell surface glycoprotein CD1a (CD1A)
Synonyms
hTa1 thymocyteantigen; hTa1 thymocyte antigen; T-cell surfaceantigen T6/Leu-6; T-cell surface antigen T6/Leu-6; CD1a
Gene Name
CD1A
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Aplastic anaemia [ICD-11: 3A70]
Function
Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
BioChemical Class
Immunoglobulin
UniProt ID
CD1A_HUMAN
Sequence
MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSN
SSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCE
LHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWEHHSSV
GFIILAVIVPLLLLIGLALWFRKRCFC
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Antithymocyte globulin Drug Info Approved Aplastic anemia [2]
Mode of Action [+] 1 Modes of Action +
Binder [+] 1 Binder drugs +
1 Antithymocyte globulin Drug Info [1]
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 1 KEGG Pathways +
1 Hematopoietic cell lineage
References
REF 1 Acute sensory neuropathy associated with rabbit antithymocyte globulin. Am J Transplant. 2007 Feb;7(2):484-6.
REF 2 Approval information for Divalproex Sodium (approved in 1996). 1996.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.