Target General Infomation
Target ID
T65291 (Former ID: TTDS00053)
Target Name
Fatty aldehyde dehydrogenase (ALDH3A2)
Synonyms
Microsomal aldehyde dehydrogenase; Aldehyde dehydrogenase family 3 member A2; Aldehyde dehydrogenase 10; ALDH10
Gene Name
ALDH3A2
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Substance abuse [ICD-11: 6C40]
Function
Catalyzes the oxidation of medium and long chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length. Responsible for conversion of the sphingosine 1-phosphate (S1P) degradation product hexadecenal to hexadecenoic acid.
BioChemical Class
Aldehyde/oxo donor oxidoreductase
UniProt ID
AL3A2_HUMAN
EC Number
EC 1.2.1.3
Sequence
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Disulfiram Drug Info Approved Alcohol dependence [2], [3]
Discontinued Drug(s) [+] 1 Discontinued Drugs +
1 NPS 1776 Drug Info Discontinued in Phase 2 Epilepsy [4]
Mode of Action [+] 2 Modes of Action +
Inhibitor [+] 4 Inhibitor drugs +
1 Disulfiram Drug Info [1]
2 Aloe-emodin Drug Info [6]
3 NSC-527035 Drug Info [7]
4 S-methyl 4-methyl-4-morpholinopent-2-ynethioate Drug Info [8]
Modulator [+] 1 Modulator drugs +
1 NPS 1776 Drug Info [5]
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target-Related Models and Studies
Target Validation
References
REF 1 Pharmacological treatment of alcohol dependence: target symptoms and target mechanisms. Pharmacol Ther. 2006 Sep;111(3):855-76.
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7168).
REF 3 Choosing the right medication for the treatment of alcoholism. Curr Psychiatry Rep. 2006 Oct;8(5):383-8.
REF 4 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010984)
REF 5 Diverse Mechanisms of Antiepileptic Drugs in the Development Pipeline. Epilepsy Res. 2006 June; 69(3): 273-294.
REF 6 Elgonica-Dimers A and B, Two Potent Alcohol Metabolism Inhibitory Constituents of Aloe arborescens J. Nat. Prod. 60(11):1180-1182 (1997).
REF 7 Exploring the structural requirements for inhibition of the ubiquitin E3 ligase breast cancer associated protein 2 (BCA2) as a treatment for breast... J Med Chem. 2010 Apr 8;53(7):2757-65.
REF 8 Aldehyde dehydrogenase inhibitors: alpha,beta-acetylenic N-substituted aminothiolesters are reversible growth inhibitors of normal epithelial but i... Eur J Med Chem. 2008 May;43(5):906-16.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.