Target General Infomation
Target ID
T66383 (Former ID: TTDC00326)
Target Name
Complement factor D (CFD)
Synonyms
Properdin factor D; PFD; DF; C3 convertase activator; Adipsin
Gene Name
CFD
Target Type
Clinical trial target
[1]
Disease [+] 2 Target-related Diseases +
1 Macular degeneration [ICD-11: 9B75]
2 Amyloidosis [ICD-11: 5D00]
Function
Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
BioChemical Class
Peptidase
UniProt ID
CFAD_HUMAN
EC Number
EC 3.4.21.46
Sequence
MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 2 Clinical Trial Drugs +
1 Anti-Factor D Drug Info Phase 1/2 Age-related macular degeneration [2]
2 ACH-4471 Drug Info Phase 1 Glomerulonephritis [3]
Mode of Action [+] 2 Modes of Action +
Inhibitor [+] 2 Inhibitor drugs +
1 ACH-4471 Drug Info [3]
2 example 373 [WO2012093101] Drug Info [4]
Modulator [+] 1 Modulator drugs +
1 HC3-1496 Drug Info [5]
Target Affiliated Biological Pathways
KEGG Pathway [+] 2 KEGG Pathways +
1 Complement and coagulation cascades
2 Staphylococcus aureus infection
NetPath Pathway [+] 1 NetPath Pathways +
1 TGF_beta_Receptor Signaling Pathway
Reactome [+] 2 Reactome Pathways +
1 Platelet degranulation
2 Alternative complement activation
WikiPathways [+] 4 WikiPathways +
1 Complement and Coagulation Cascades
2 Human Complement System
3 Adipogenesis
4 Complement cascade
References
REF 1 Association for Research in Vision and Ophthalmology (ARVO)--2010 Annual Meeting. For Sight: The Future of Eye and Vision Research--part 1. IDrugs. 2010 Jul;13(7):427-9.
REF 2 Clinical pipeline report, company report or official report of Genentech (2011).
REF 3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 4 Factor D Inhibitors for the Treatment of AMD: Patent Highlight. ACS Med Chem Lett. 2012 Aug 27;3(10):781-2.
REF 5 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2842).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.