Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T75596
(Former ID: TTDR00721)
|
|||||
Target Name |
Methionine aminopeptidase 2 (METAP2)
|
|||||
Synonyms |
Peptidase M 2; P67eIF2; P67; MetAP 2; METAP2; Initiation factor 2 associated 67 kDa glycoprotein; (MetAP)-2
|
|||||
Gene Name |
METAP2
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val).
Click to Show/Hide
|
|||||
BioChemical Class |
Peptidase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.4.11.18
|
|||||
Sequence |
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
1 | Beloranib | Drug Info | Phase 3 | Solid tumour/cancer | [2], [3] | |
2 | ZGN-1061 | Drug Info | Phase 2 | Type 2 diabetes | [4] | |
3 | M8891 | Drug Info | Phase 1 | Solid tumour/cancer | [5] | |
4 | PPI-2458 | Drug Info | Phase 1 | Autoimmune diabetes | [6] | |
5 | SDX-7320 | Drug Info | Phase 1 | Solid tumour/cancer | [5] | |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | TNP-470 | Drug Info | Discontinued in Phase 2 | Solid tumour/cancer | [7] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 30 Inhibitor drugs | + | ||||
1 | Beloranib | Drug Info | [1], [8] | |||
2 | D-Methionine | Drug Info | [9] | |||
3 | ZGN-1061 | Drug Info | [10] | |||
4 | M8891 | Drug Info | [5] | |||
5 | PPI-2458 | Drug Info | [11] | |||
6 | SDX-7320 | Drug Info | [5] | |||
7 | TNP-470 | Drug Info | [12] | |||
8 | 2-(4-fluorophenylsulfonamido)-1-naphthoic acid | Drug Info | [13] | |||
9 | 2-(phenylsulfonamido)-1-naphthoic acid | Drug Info | [13] | |||
10 | 2-(phenylsulfonamido)-5-propylbenzoic acid | Drug Info | [13] | |||
11 | 2-(pyridin-2-yl)-1H-benzo[d]imidazol-5-amine | Drug Info | [14] | |||
12 | 2-(pyridin-2-yl)-1H-benzo[d]imidazole | Drug Info | [14] | |||
13 | 2-(pyridin-2-yl)-1H-imidazo[4,5-c]pyridine | Drug Info | [14] | |||
14 | 2-(thiazol-4-yl)-1H-benzo[d]imidazol-5-amine | Drug Info | [14] | |||
15 | 2-Methyl-2-Propanol | Drug Info | [9] | |||
16 | 3,5,6,8-Tetramethyl-N-Methyl Phenanthrolinium | Drug Info | [9] | |||
17 | 3,5-dimethyl-2-(phenylsulfonamido)benzoic acid | Drug Info | [13] | |||
18 | 3-anilino-5-benzylthio-1,2,4-triazole | Drug Info | [15] | |||
19 | 5-bromo-2-(4-chlorophenylsulfonamido)benzoic acid | Drug Info | [13] | |||
20 | 5-butyl-2-(phenylsulfonamido)benzoic acid | Drug Info | [13] | |||
21 | 5-chloro-2-(pyridin-2-yl)-1H-benzo[d]imidazole | Drug Info | [14] | |||
22 | 5-ethyl-2-(phenylsulfonamido)benzoic acid | Drug Info | [13] | |||
23 | 5-fluoro-2-(pyridin-2-yl)-1H-benzo[d]imidazole | Drug Info | [14] | |||
24 | 5-methyl-2-(phenylsulfonamido)benzoic acid | Drug Info | [16], [17] | |||
25 | 5-methyl-2-(pyridin-2-yl)-1H-benzo[d]imidazole | Drug Info | [14] | |||
26 | 5-p-Tolyl-1H-[1,2,3]triazole | Drug Info | [18] | |||
27 | A-357300 | Drug Info | [12] | |||
28 | Ovalicin | Drug Info | [9] | |||
29 | OXYQUINOLINE | Drug Info | [14] | |||
30 | XMT-1191 | Drug Info | [20] | |||
Binder | [+] 1 Binder drugs | + | ||||
1 | Fumagillin | Drug Info | [19] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | Inactivation, recovery and regulation of the phototransduction cascade |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | 2011 Pipeline of Zafgen. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8445). | |||||
REF 3 | ClinicalTrials.gov (NCT02179151) Double-Blind, Placebo Controlled, Phase 3 Trial of ZGN-440 (Beloranib) in Obese Subjects With Prader-Willi Syndrome. U.S. National Institutes of Health. | |||||
REF 4 | ClinicalTrials.gov (NCT03254368) Study to Assess the Effects and Safety of ZGN-1061 in Overweight and Obese Participants With Type 2 Diabetes. U.S. National Institutes of Health. | |||||
REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 6 | ClinicalTrials.gov (NCT00100347) Safety/Tolerance Study of PPI-2458 in Subjects With Non-Hodgkin's Lymphoma and Solid Tumors. U.S. National Institutes of Health. | |||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001587) | |||||
REF 8 | Inhibition of the methionine aminopeptidase 2 enzyme for the treatment of obesity. Diabetes Metab Syndr Obes. 2014 Feb 28;7:73-84. | |||||
REF 9 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 10 | The methionine aminopeptidase 2 inhibitor ZGN-1061 improves glucose control and weight in overweight and obese individuals with type 2 diabetes: A randomized, placebo-controlled trial. Diabetes Obes Metab. 2020 Jul;22(7):1215-1219. | |||||
REF 11 | Metabolites of PPI-2458, a selective, irreversible inhibitor of methionine aminopeptidase-2: structure determination and in vivo activity. Drug Metab Dispos. 2013 Apr;41(4):814-26. | |||||
REF 12 | Tumor suppression by a rationally designed reversible inhibitor of methionine aminopeptidase-2. Cancer Res. 2003 Nov 15;63(22):7861-9. | |||||
REF 13 | Development of sulfonamide compounds as potent methionine aminopeptidase type II inhibitors with antiproliferative properties. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3574-7. | |||||
REF 14 | Subtype-selectivity of metal-dependent methionine aminopeptidase inhibitors, Bioorg. Med. Chem. Lett. 20(14):4038-4044 (2010). | |||||
REF 15 | Highly potent inhibitors of methionine aminopeptidase-2 based on a 1,2,4-triazole pharmacophore. J Med Chem. 2007 Aug 9;50(16):3777-85. | |||||
REF 16 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
REF 17 | Discovery and optimization of anthranilic acid sulfonamides as inhibitors of methionine aminopeptidase-2: a structural basis for the reduction of a... J Med Chem. 2006 Jun 29;49(13):3832-49. | |||||
REF 18 | 4-Aryl-1,2,3-triazole: a novel template for a reversible methionine aminopeptidase 2 inhibitor, optimized to inhibit angiogenesis in vivo. J Med Chem. 2005 Sep 8;48(18):5644-7. | |||||
REF 19 | Homology modeling and calculation of the cobalt cluster charges of the Encephazlitozoon cuniculi methionine aminopeptidase, a potential target for drug design. Biophys Chem. 2003 Aug 1;105(1):29-43. | |||||
REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1573). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.