Target General Infomation
Target ID
T77009 (Former ID: TTDI00956)
Target Name
Thioredoxin reductase (PRDX5)
Synonyms
Thioredoxin peroxidase PMP20; TPx type VI; SBBI10; PrxV; Prx-V; Peroxisomal antioxidant enzyme; Peroxiredoxin5, mitochondrial; Peroxiredoxin-5, mitochondrial; Peroxiredoxin V; PLP; Liver tissue 2Dpage spot 71B; Liver tissue 2D-page spot 71B; Antioxidant enzyme B166; Alu corepressor 1; AOEB166; ACR1
Gene Name
PRDX5
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Brain cancer [ICD-11: 2A00]
Function
Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.
BioChemical Class
Peroxide acceptor oxidoreductase
UniProt ID
PRDX5_HUMAN
EC Number
EC 1.11.1.15
Sequence
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGD
AIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGV
QVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKR
FSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Motexafin gadolinium Drug Info Approved Brain cancer [2]
Mode of Action [+] 1 Modes of Action +
Modulator [+] 1 Modulator drugs +
1 Motexafin gadolinium Drug Info [1]
Target Regulators
Target-interacting Proteins
References
REF 1 Mechanism of inhibition of ribonucleotide reductase with motexafin gadolinium (MGd). Biochem Biophys Res Commun. 2009 Feb 13;379(3):775-9.
REF 2 Photodynamic therapy: applications in atherosclerotic vascular disease with motexafin lutetium. Catheter Cardiovasc Interv. 2002 Nov;57(3):387-94.
REF 3 Thioredoxin reductase inhibitors: a patent review.Expert Opin Ther Pat. 2017 May;27(5):547-556.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.