Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T78709
(Former ID: TTDS00098)
|
|||||
Target Name |
5-HT 1A receptor (HTR1A)
|
|||||
Synonyms |
Serotonin receptor 1A; G-21; ADRBRL1; ADRB2RL1; 5-hydroxytryptamine receptor 1A; 5-HT1A receptor; 5-HT1A; 5-HT-1A
|
|||||
Gene Name |
HTR1A
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 5 Target-related Diseases | + | ||||
1 | Anxiety disorder [ICD-11: 6B00-6B0Z] | |||||
2 | Depression [ICD-11: 6A70-6A7Z] | |||||
3 | Hypertension [ICD-11: BA00-BA04] | |||||
4 | Migraine [ICD-11: 8A80] | |||||
5 | Mood disorder [ICD-11: 6A60-6E23] | |||||
Function |
Functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli. G-protein coupled receptor for 5-hydroxytryptamine (serotonin).
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 8 Approved Drugs | + | ||||
1 | Buspirone | Drug Info | Approved | Anxiety disorder | [2], [3] | |
2 | Flibanserin | Drug Info | Approved | Mood disorder | [4], [5] | |
3 | OPC-34712 | Drug Info | Approved | Major depressive disorder | [6], [7] | |
4 | TERTATOLOL | Drug Info | Approved | Hypertension | [8], [9] | |
5 | Trazodone | Drug Info | Approved | Depression | [10], [11] | |
6 | Treximet | Drug Info | Approved | Migraine | [12] | |
7 | Urapidil | Drug Info | Approved | Hypertension | [9] | |
8 | Vilazodone | Drug Info | Approved | Major depressive disorder | [13], [14] | |
Clinical Trial Drug(s) | [+] 32 Clinical Trial Drugs | + | ||||
1 | CM-2395 | Drug Info | Phase 3 | Schizophrenia | [15] | |
2 | Eltoprazine | Drug Info | Phase 3 | Attention deficit hyperactivity disorder | [16] | |
3 | SEP-363856 | Drug Info | Phase 3 | Schizophrenia | [17] | |
4 | Xaliproden | Drug Info | Phase 3 | Juvenile idiopathic arthritis | [18] | |
5 | LECOZOTAN HYDROCHLORIDE | Drug Info | Phase 2/3 | Cognitive impairment | [19] | |
6 | Sarizotan | Drug Info | Phase 2/3 | Rett syndrome | [20] | |
7 | Ensaculin hydrochloride | Drug Info | Phase 2 | Parkinson disease | [21] | |
8 | FKW00GA | Drug Info | Phase 2 | Social phobia | [16] | |
9 | Mazapertine succinate | Drug Info | Phase 2 | Psychotic disorder | [22] | |
10 | MIN-117 | Drug Info | Phase 2 | Major depressive disorder | [23] | |
11 | MN-305 | Drug Info | Phase 2 | Mood disorder | [24] | |
12 | Neu-P11 | Drug Info | Phase 2 | Insomnia | [25] | |
13 | OPC-14523 | Drug Info | Phase 2 | Mood disorder | [26] | |
14 | ORG-13011 | Drug Info | Phase 2 | Psychotic disorder | [27] | |
15 | RP5063 | Drug Info | Phase 2 | Schizophrenia | [28] | |
16 | S-15535 | Drug Info | Phase 2 | Anxiety disorder | [29], [30] | |
17 | S-16924 | Drug Info | Phase 2 | Anxiety disorder | [31], [32], [33] | |
18 | SDZ-MAR-327 | Drug Info | Phase 2 | Psychotic disorder | [34], [35] | |
19 | SUN N4057 | Drug Info | Phase 2 | Coronary artery disease | [36] | |
20 | TGBA01AD | Drug Info | Phase 2 | Mood disorder | [24] | |
21 | TGFK08AA | Drug Info | Phase 2 | Generalized anxiety disorder | [37] | |
22 | TGFK09SD | Drug Info | Phase 2 | Hypoactive sexual desire dysfunction | [38] | |
23 | TGWOOAA | Drug Info | Phase 2 | Social phobia | [39] | |
24 | Zalospirone | Drug Info | Phase 2 | Anxiety disorder | [40], [41] | |
25 | 1192U90 | Drug Info | Phase 1 | Psychotic disorder | [42] | |
26 | AV-965 | Drug Info | Phase 1 | Alzheimer disease | [43] | |
27 | DSP-1053 | Drug Info | Phase 1 | Major depressive disorder | [44] | |
28 | GSK-958108 | Drug Info | Phase 1 | Premature ejaculation | [45] | |
29 | NLX-101 | Drug Info | Phase 1 | Rett syndrome | [46] | |
30 | SKL-PSY | Drug Info | Phase 1 | Bipolar disorder | [47] | |
31 | SSR-181507 | Drug Info | Phase 1 | Schizophrenia | [34] | |
32 | Umespirone | Drug Info | Phase 1 | Anxiety disorder | [48] | |
Patented Agent(s) | [+] 5 Patented Agents | + | ||||
1 | PMID30124346-Compound-13TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [49] | |
2 | PMID30124346-Compound-34TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [49] | |
3 | PMID30124346-Compound-60TABLE5 | Drug Info | Patented | Parkinson disease | [49], [50], [51] | |
4 | PMID30124346-Compound-LDT66 | Drug Info | Patented | Benign prostatic hyperplasia | [49] | |
5 | PMID30124346-Compound-LDT8 | Drug Info | Patented | Benign prostatic hyperplasia | [49] | |
Discontinued Drug(s) | [+] 36 Discontinued Drugs | + | ||||
1 | LYSERGIC ACID DIETHYLAMIDE | Drug Info | Withdrawn from market | Addictive disorder | [52], [53] | |
2 | Bifeprunox | Drug Info | Discontinued in Phase 3 | Schizophrenia | [34] | |
3 | BMS-181100 | Drug Info | Discontinued in Phase 3 | Psychotic disorder | [54], [55] | |
4 | Flesinoxan | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [56], [57] | |
5 | Adatanserin | Drug Info | Discontinued in Phase 2 | Mood disorder | [24] | |
6 | ALNESPIRONE | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [58] | |
7 | AP-521 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [59] | |
8 | DU 125530 | Drug Info | Discontinued in Phase 2 | Mood disorder | [60] | |
9 | GSK163090 | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [61] | |
10 | LESOPITRON DIHYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Mood disorder | [62] | |
11 | PRX-00023 | Drug Info | Discontinued in Phase 2 | Mood disorder | [24] | |
12 | REC-15/3079 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [63], [64] | |
13 | Robalzotan | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [65], [66] | |
14 | BINOSPIRONE MESYLATE | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [67] | |
15 | DU-29894 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [68] | |
16 | E2101 | Drug Info | Discontinued in Phase 1 | Spasm | [69] | |
17 | Ebalzotan | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [70] | |
18 | Eptapirone | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [71] | |
19 | GR-127607 | Drug Info | Discontinued in Phase 1 | Migraine | [72] | |
20 | Nerisopam | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [73] | |
21 | SLV-313 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [34] | |
22 | SUN-8399 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [74] | |
23 | U-93385 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [75] | |
24 | A-74283 | Drug Info | Terminated | Hypertension | [77] | |
25 | Anpirtoline | Drug Info | Terminated | Pain | [78] | |
26 | BTS-79018 | Drug Info | Terminated | Schizophrenia | [34] | |
27 | CGS-18102A | Drug Info | Terminated | Anxiety disorder | [79] | |
28 | Du-123015 | Drug Info | Terminated | Anxiety disorder | [80] | |
29 | Gepirone | Drug Info | Terminated | Depression | [24] | |
30 | HT-90B | Drug Info | Terminated | Anxiety disorder | [81] | |
31 | Ipsapirone | Drug Info | Terminated | Anxiety disorder | [82], [83] | |
32 | LY-293284 | Drug Info | Terminated | Anxiety disorder | [84], [85] | |
33 | RWJ-25730 | Drug Info | Terminated | Psychotic disorder | [86] | |
34 | S-14506 | Drug Info | Terminated | Anxiety disorder | [87], [88] | |
35 | SLV-307 | Drug Info | Terminated | Parkinson disease | [89] | |
36 | WAY-100635 | Drug Info | Terminated | Eating disorder | [90], [91] | |
Preclinical Drug(s) | [+] 2 Preclinical Drugs | + | ||||
1 | CM-2236 | Drug Info | Preclinical | Post-traumatic stress disorder | [76] | |
2 | PD-158771 | Drug Info | Preclinical | Schizophrenia | [34] | |
Mode of Action | [+] 7 Modes of Action | + | ||||
Agonist | [+] 50 Agonist drugs | + | ||||
1 | Buspirone | Drug Info | [1] | |||
2 | Urapidil | Drug Info | [97] | |||
3 | CM-2395 | Drug Info | [98] | |||
4 | Eltoprazine | Drug Info | [99] | |||
5 | SEP-363856 | Drug Info | [20] | |||
6 | MN-305 | Drug Info | [24] | |||
7 | Neu-P11 | Drug Info | [105] | |||
8 | SUN N4057 | Drug Info | [113] | |||
9 | Zalospirone | Drug Info | [41] | |||
10 | 1192U90 | Drug Info | [34] | |||
11 | Aryl piperazine derivative 14 | Drug Info | [49] | |||
12 | Aryl piperazine derivative 15 | Drug Info | [49] | |||
13 | Aryl piperazine derivative 16 | Drug Info | [49] | |||
14 | PMID30124346-Compound-13TABLE4 | Drug Info | [49] | |||
15 | Flesinoxan | Drug Info | [129] | |||
16 | Adatanserin | Drug Info | [24], [132] | |||
17 | ALNESPIRONE | Drug Info | [133], [9] | |||
18 | AP-521 | Drug Info | [134], [9] | |||
19 | LESOPITRON DIHYDROCHLORIDE | Drug Info | [136] | |||
20 | Ebalzotan | Drug Info | [144] | |||
21 | Eptapirone | Drug Info | [145] | |||
22 | GR-127607 | Drug Info | [146] | |||
23 | Nerisopam | Drug Info | [147] | |||
24 | SUN-8399 | Drug Info | [149] | |||
25 | U-93385 | Drug Info | [150], [9] | |||
26 | CM-2236 | Drug Info | [151] | |||
27 | A-74283 | Drug Info | [152] | |||
28 | Gepirone | Drug Info | [24] | |||
29 | Ipsapirone | Drug Info | [159] | |||
30 | LY-293284 | Drug Info | [160] | |||
31 | 1-naphthylpiperazine | Drug Info | [184], [173] | |||
32 | 5-CT | Drug Info | [199] | |||
33 | 7-methoxy-1-naphthylpiperazine | Drug Info | [184] | |||
34 | BRL-15572 | Drug Info | [203] | |||
35 | CP 93129 | Drug Info | [199] | |||
36 | EDMT | Drug Info | [206] | |||
37 | FG-5893 | Drug Info | [210] | |||
38 | L-772,405 | Drug Info | [212] | |||
39 | LP-12 | Drug Info | [213] | |||
40 | LP-211 | Drug Info | [214] | |||
41 | LP-44 | Drug Info | [213] | |||
42 | LY 165,163 | Drug Info | [210] | |||
43 | nafadotride | Drug Info | [210] | |||
44 | piribedil | Drug Info | [221] | |||
45 | S-14671 | Drug Info | [111] | |||
46 | SB 216641 | Drug Info | [203] | |||
47 | spiroxatrine | Drug Info | [210] | |||
48 | U92016A | Drug Info | [231] | |||
49 | [3H]8-OH-DPAT | Drug Info | [236] | |||
50 | [3H]NLX-112 | Drug Info | [237] | |||
Modulator | [+] 34 Modulator drugs | + | ||||
1 | Flibanserin | Drug Info | [5] | |||
2 | OPC-34712 | Drug Info | [92], [93] | |||
3 | Trazodone | Drug Info | [95] | |||
4 | Vilazodone | Drug Info | [14] | |||
5 | Sarizotan | Drug Info | [102] | |||
6 | Ensaculin hydrochloride | Drug Info | [21], [103] | |||
7 | FKB01MD | Drug Info | [16] | |||
8 | Mazapertine succinate | Drug Info | [102] | |||
9 | OPC-14523 | Drug Info | [106] | |||
10 | S-16924 | Drug Info | [32], [33] | |||
11 | SDZ-MAR-327 | Drug Info | [112] | |||
12 | TGBA01AD | Drug Info | [114] | |||
13 | TGFK08AA | Drug Info | [115] | |||
14 | TGFK09SD | Drug Info | [116] | |||
15 | NLX-101 | Drug Info | [121] | |||
16 | SKL-PSY | Drug Info | [122] | |||
17 | SSR-181507 | Drug Info | [123] | |||
18 | Bifeprunox | Drug Info | [126] | |||
19 | BMS-181100 | Drug Info | [127], [128] | |||
20 | PRX-00023 | Drug Info | [138] | |||
21 | DU-29894 | Drug Info | [142] | |||
22 | E2101 | Drug Info | [143] | |||
23 | SLV-313 | Drug Info | [148] | |||
24 | Anpirtoline | Drug Info | [78] | |||
25 | CGS-18102A | Drug Info | [155] | |||
26 | Du-123015 | Drug Info | [157] | |||
27 | HT-90B | Drug Info | [158] | |||
28 | RWJ-25730 | Drug Info | [162] | |||
29 | S-14506 | Drug Info | [163] | |||
30 | CGS-19480A | Drug Info | [204], [9] | |||
31 | EMD 56551 | Drug Info | [207] | |||
32 | NPT-500 | Drug Info | [122] | |||
33 | SEL-73 | Drug Info | [122] | |||
34 | SR-59026 | Drug Info | [230] | |||
Inhibitor | [+] 142 Inhibitor drugs | + | ||||
1 | TERTATOLOL | Drug Info | [94] | |||
2 | LYSERGIC ACID DIETHYLAMIDE | Drug Info | [125] | |||
3 | Sunepitron | Drug Info | [130] | |||
4 | TIOSPIRONE | Drug Info | [131] | |||
5 | MAZAPERTINE | Drug Info | [137] | |||
6 | A-80426 | Drug Info | [153] | |||
7 | BMY-7378 | Drug Info | [154] | |||
8 | CP-293019 | Drug Info | [156] | |||
9 | WB-4101 | Drug Info | [168] | |||
10 | (3-Chloro-phenyl)-piperazin-1-yl-methanone | Drug Info | [169] | |||
11 | (R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [170] | |||
12 | (R)-11-Amino-2-methoxyaporphine | Drug Info | [171] | |||
13 | (R)-2,11-Diaminoaporphine | Drug Info | [171] | |||
14 | 1,2,3,4-Tetrahydro-naphthalen-2-ylamine | Drug Info | [173] | |||
15 | 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [174] | |||
16 | 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [174] | |||
17 | 1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [174] | |||
18 | 1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [174] | |||
19 | 1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [174] | |||
20 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [175] | |||
21 | 1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine | Drug Info | [169] | |||
22 | 1-(2,5-Dimethoxy-phenyl)-piperazine | Drug Info | [169] | |||
23 | 1-(2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [176] | |||
24 | 1-(2-((3-fluorophenoxy)methyl)phenyl)piperazine | Drug Info | [177] | |||
25 | 1-(2-(2-chlorophenoxy)pyridin-3-yl)piperazine | Drug Info | [178] | |||
26 | 1-(2-(2-fluorobenzyloxy)phenyl)piperazine | Drug Info | [177] | |||
27 | 1-(2-(3-fluorophenoxy)phenyl)piperazine | Drug Info | [177] | |||
28 | 1-(2-(4-fluorophenoxy)phenyl)piperazine | Drug Info | [177] | |||
29 | 1-(2-(benzyloxy)phenyl)piperazine | Drug Info | [177] | |||
30 | 1-(2-(phenoxymethyl)phenyl)piperazine | Drug Info | [177] | |||
31 | 1-(2-Butoxy-phenyl)-piperazine | Drug Info | [179] | |||
32 | 1-(2-Chloro-phenyl)-piperazine | Drug Info | [180] | |||
33 | 1-(2-Ethoxy-phenyl)-piperazine | Drug Info | [179] | |||
34 | 1-(2-Fluoro-phenyl)-piperazine | Drug Info | [179] | |||
35 | 1-(2-Isopropoxy-phenyl)-piperazine | Drug Info | [179] | |||
36 | 1-(2-Methoxy-phenyl)-4-propyl-piperazine | Drug Info | [181] | |||
37 | 1-(2-Methoxy-phenyl)-piperazine | Drug Info | [180] | |||
38 | 1-(2-methoxyphenyl)-4-pentylpiperazine | Drug Info | [182] | |||
39 | 1-(2-phenoxyphenyl)piperazine | Drug Info | [177] | |||
40 | 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [183] | |||
41 | 1-(3-Fluoro-phenyl)-piperazine | Drug Info | [179] | |||
42 | 1-(3-Nitro-phenyl)-piperazine | Drug Info | [179] | |||
43 | 1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine | Drug Info | [169] | |||
44 | 1-(7-Methoxy-naphthalen-2-yl)-piperazine | Drug Info | [184] | |||
45 | 1-(benzyloxy)-2-(2-phenylethyl)benzene | Drug Info | [185] | |||
46 | 1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene | Drug Info | [185] | |||
47 | 1-Benzyl-4-chroman-2-ylmethyl-piperazine | Drug Info | [186] | |||
48 | 1-Butyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [181] | |||
49 | 1-Ethyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [181] | |||
50 | 1-Methyl-1,3-dihydro-indol-2-one | Drug Info | [187] | |||
51 | 1-Naphthalen-2-yl-piperazine | Drug Info | [173] | |||
52 | 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [188] | |||
53 | 1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene | Drug Info | [185] | |||
54 | 2-(2'-methyl-biphenyl-3-yl)-ethylamine | Drug Info | [189] | |||
55 | 2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol | Drug Info | [176] | |||
56 | 2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [178] | |||
57 | 2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [178] | |||
58 | 2-(2-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [176] | |||
59 | 2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [178] | |||
60 | 2-(3-Bromophenylthio)-N,N-dimethylethanamine | Drug Info | [190] | |||
61 | 2-(3-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [176] | |||
62 | 2-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [186] | |||
63 | 2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [176] | |||
64 | 2-(4-Bromo-phenyl)-1-methyl-ethylamine | Drug Info | [176] | |||
65 | 2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine | Drug Info | [191] | |||
66 | 2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine | Drug Info | [192] | |||
67 | 2-(Biphenyl-3-ylthio)-N,N-dimethylethanamine | Drug Info | [190] | |||
68 | 2-Dipropylamino-1,2,3,4-tetrahydro-anthracen-9-ol | Drug Info | [94] | |||
69 | 2-phenoxy-3-(piperidin-4-yl)pyridine | Drug Info | [178] | |||
70 | 2-Piperazin-1-yl-benzonitrile | Drug Info | [179] | |||
71 | 2-Piperazin-1-yl-phenol | Drug Info | [169] | |||
72 | 2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [185] | |||
73 | 3-(1,2,3,6-Tetrahydro-pyridin-4-yl)-1H-indole | Drug Info | [193] | |||
74 | 3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [188] | |||
75 | 3-(2-Amino-propyl)-1H-indol-5-ol | Drug Info | [192] | |||
76 | 3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [194] | |||
77 | 3-(3-Methanesulfonyl-phenyl)-1-propyl-pyrrolidine | Drug Info | [188] | |||
78 | 3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [186] | |||
79 | 3-(4-Benzyl-piperidin-1-ylmethyl)-chromen-4-one | Drug Info | [186] | |||
80 | 3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine | Drug Info | [178] | |||
81 | 3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one | Drug Info | [169] | |||
82 | 3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [195] | |||
83 | 3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [195] | |||
84 | 3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [188] | |||
85 | 3-Naphthalen-1-yl-pyrrolidine | Drug Info | [188] | |||
86 | 3-Phenyl-1-propyl-pyrrolidine | Drug Info | [188] | |||
87 | 3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [185] | |||
88 | 4-(1H-indol-4-yloxy)-1-(isopropylamino)butan-2-ol | Drug Info | [196] | |||
89 | 4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine | Drug Info | [177] | |||
90 | 4-(2-(2-fluorobenzyloxy)phenyl)piperidine | Drug Info | [177] | |||
91 | 4-(2-(3-chlorophenoxy)phenyl)piperidine | Drug Info | [177] | |||
92 | 4-(2-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [177] | |||
93 | 4-(2-(4-fluorobenzyloxy)phenyl)piperidine | Drug Info | [177] | |||
94 | 4-(2-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [177] | |||
95 | 4-(2-(benzyloxy)-3-fluorophenyl)piperidine | Drug Info | [177] | |||
96 | 4-(2-(benzyloxy)-6-fluorophenyl)piperidine | Drug Info | [177] | |||
97 | 4-(2-(benzyloxy)phenyl)piperidine | Drug Info | [177] | |||
98 | 4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine | Drug Info | [178] | |||
99 | 4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [177] | |||
100 | 4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [177] | |||
101 | 4-(2-fluoro-6-phenoxyphenyl)piperidine | Drug Info | [177] | |||
102 | 4-(2-phenoxyphenyl)piperidine | Drug Info | [177] | |||
103 | 4-(3-fluoro-2-phenoxyphenyl)piperidine | Drug Info | [177] | |||
104 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [197] | |||
105 | 4-Benzyl-1-chroman-2-ylmethyl-piperidine | Drug Info | [186] | |||
106 | 4-Benzyl-1-chroman-3-ylmethyl-piperidine | Drug Info | [186] | |||
107 | 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [198] | |||
108 | 5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [198] | |||
109 | 5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine | Drug Info | [198] | |||
110 | 5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [198] | |||
111 | 8-Methoxy-1,2,3,4-tetrahydro-naphthalen-2-ylamine | Drug Info | [94] | |||
112 | 8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline | Drug Info | [173] | |||
113 | 8-Methoxy-2-piperazin-1-yl-quinoline | Drug Info | [173] | |||
114 | 8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [198] | |||
115 | 8-Methoxy-quinolin-2-ylamine | Drug Info | [173] | |||
116 | 9-Methoxy-1,2,3,4-tetrahydro-anthracen-2-ylamine | Drug Info | [94] | |||
117 | A-987306 | Drug Info | [201] | |||
118 | AGROCLAVINE | Drug Info | [202] | |||
119 | Brolamfetamine | Drug Info | [176] | |||
120 | CHLOROPHENYLPIPERAZINE | Drug Info | [179] | |||
121 | ESCHOLTZINE | Drug Info | [208] | |||
122 | Etisulergine | Drug Info | [209] | |||
123 | JNJ-10392980 | Drug Info | [211] | |||
124 | MCL-516 | Drug Info | [171] | |||
125 | N-(3-(1H-indol-4-yloxy)propyl)cyclohexanamine | Drug Info | [196] | |||
126 | N-(3-(1H-indol-4-yloxy)propyl)cyclopentanamine | Drug Info | [196] | |||
127 | N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide | Drug Info | [214] | |||
128 | N-methyllaurotetanine | Drug Info | [208] | |||
129 | N-[4-(4-Phenyl-piperazin-1-yl)-butyl]-benzamide | Drug Info | [216] | |||
130 | PB-28 | Drug Info | [219] | |||
131 | PG-01037 | Drug Info | [220] | |||
132 | PHENYLPIPERAZINE | Drug Info | [173] | |||
133 | QUIPAZINE | Drug Info | [222] | |||
134 | SB-271046 | Drug Info | [227] | |||
135 | SB-656104 | Drug Info | [228] | |||
136 | SEROTONIN | Drug Info | [222] | |||
137 | SNAP-8719 | Drug Info | [229] | |||
138 | TFMPP | Drug Info | [169] | |||
139 | UH-232 | Drug Info | [232] | |||
140 | UH-301 | Drug Info | [233] | |||
141 | WAY-466 | Drug Info | [234] | |||
142 | [3H]spiperone | Drug Info | [168] | |||
Antagonist | [+] 41 Antagonist drugs | + | ||||
1 | Treximet | Drug Info | [96] | |||
2 | Xaliproden | Drug Info | [100] | |||
3 | LECOZOTAN HYDROCHLORIDE | Drug Info | [9], [101] | |||
4 | FKW00GA | Drug Info | [16] | |||
5 | MIN-117 | Drug Info | [104] | |||
6 | ORG-13011 | Drug Info | [9], [107] | |||
7 | RP5063 | Drug Info | [108], [109] | |||
8 | S-15535 | Drug Info | [9], [110], [111] | |||
9 | TGWOOAA | Drug Info | [117] | |||
10 | AV-965 | Drug Info | [118] | |||
11 | DSP-1053 | Drug Info | [119] | |||
12 | GSK-958108 | Drug Info | [120] | |||
13 | Umespirone | Drug Info | [124] | |||
14 | PMID30124346-Compound-LDT8 | Drug Info | [49] | |||
15 | DU 125530 | Drug Info | [135] | |||
16 | GSK163090 | Drug Info | [96] | |||
17 | REC-15/3079 | Drug Info | [139] | |||
18 | Robalzotan | Drug Info | [140] | |||
19 | BINOSPIRONE MESYLATE | Drug Info | [141], [9] | |||
20 | PD-158771 | Drug Info | [34] | |||
21 | NAN-190 | Drug Info | [161] | |||
22 | SDZ 216-525 | Drug Info | [161] | |||
23 | SLV-307 | Drug Info | [164] | |||
24 | WAY-100635 | Drug Info | [135], [165], [166], [167] | |||
25 | (R)-flurocarazolol | Drug Info | [172] | |||
26 | (S)-flurocarazolol | Drug Info | [172] | |||
27 | 9-OH-risperidone | Drug Info | [200] | |||
28 | cyamemazine | Drug Info | [205] | |||
29 | GR 125,743 | Drug Info | [199] | |||
30 | LY433221 | Drug Info | [215] | |||
31 | MPDT | Drug Info | [206] | |||
32 | P-MPPI | Drug Info | [217], [161] | |||
33 | p-[18F]MPPF | Drug Info | [218] | |||
34 | repinotan | Drug Info | [223] | |||
35 | SB 272183 | Drug Info | [225] | |||
36 | SB 649915 | Drug Info | [226] | |||
37 | SB 714786 | Drug Info | [226] | |||
38 | WAY 100135 | Drug Info | [161] | |||
39 | [11C]WAY100635 | Drug Info | [235] | |||
40 | [3H]p-MPPF | Drug Info | [238] | |||
41 | [3H]robalzotan | Drug Info | [239] | |||
Ligand | [+] 4 Ligand drugs | + | ||||
1 | Aryl piperazine derivative 1 | Drug Info | [49] | |||
2 | Aryl piperazine derivative 6 | Drug Info | [49] | |||
3 | PMID30124346-Compound-34TABLE4 | Drug Info | [49] | |||
4 | PMID30124346-Compound-60TABLE5 | Drug Info | [49] | |||
Binder | [+] 1 Binder drugs | + | ||||
1 | BTS-79018 | Drug Info | [34] | |||
Modulator (allosteric modulator) | [+] 1 Modulator (allosteric modulator) drugs | + | ||||
1 | RS-30199 | Drug Info | [224] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating Transcription Factors |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | cAMP signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | Serotonergic synapse | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | 5HT1 type receptor mediated signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Serotonin receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 6 WikiPathways | + | ||||
1 | Serotonin HTR1 Group and FOS Pathway | |||||
2 | SIDS Susceptibility Pathways | |||||
3 | Monoamine GPCRs | |||||
4 | GPCRs, Class A Rhodopsin-like | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Interactions between corticotropin-releasing hormone and serotonin: implications for the aetiology and treatment of anxiety disorders. Handb Exp Pharmacol. 2005;(169):181-204. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 36). | |||||
REF 3 | Glutamate and anxiety disorders. Curr Psychiatry Rep. 2007 Aug;9(4):278-83. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8182). | |||||
REF 5 | Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672). | |||||
REF 7 | ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 64). | |||||
REF 9 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 213). | |||||
REF 11 | Emerging treatments for depression. Expert Opin Pharmacother. 2006 Dec;7(17):2323-39. | |||||
REF 12 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021926. | |||||
REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7427). | |||||
REF 14 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | |||||
REF 15 | Pharmaceutical Research Companies Are Developing More Than 300 Medicines to Treat Mental Illnesses. Pharmaceutical Research and Manufacturers of America report.2010. | |||||
REF 16 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 17 | ClinicalTrials.gov (NCT04109950) A Clinical Study to Evaluate the Long-term Safety and Tolerability of an Investigational Drug in People With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 18 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 19 | ClinicalTrials.gov (NCT00277810) Study Evaluating the Safety, Tolerability, and Efficacy of Lecozotan SR in Outpatients With Alzheimer's Disease. U.S. National Institutes of Health. | |||||
REF 20 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 21 | Ensaculin (KA-672 HCl): a multitransmitter approach to dementia treatment. CNS Drug Rev. 2002 Summer;8(2):143-58. | |||||
REF 22 | Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009. | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037483) | |||||
REF 24 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 25 | ClinicalTrials.gov (NCT01489969) Sleep Laboratory Study to Investigate the Safety and Efficacy of Neu-P11 in Primary Insomnia Patients. U.S. National Institutes of Health. | |||||
REF 26 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. | |||||
REF 27 | ClinicalTrials.gov (NCT00000189) Gepirone vs Placebo in Treatment of Cocaine Dependence - 3. U.S. National Institutes of Health. | |||||
REF 28 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 26). | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002186) | |||||
REF 31 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 167). | |||||
REF 32 | S 16924 ((R)-2-[1-[2-(2,3-dihydro-benzo[1,4] dioxin-5-Yloxy)-ethyl]-pyrrolidin-3yl]-1-(4-fluoro-phenyl)-ethanone), a novel, potential antipsychotic with marked serotonin (5-HT)1A agonist properties: I. Receptorial and neurochemical profile in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1998 Sep;286(3):1341-55. | |||||
REF 33 | S-16924 [(R)-2-[1-[2-(2,3-dihydro-benzo[1,4]dioxin-5-yloxy)-ethyl]- pyrrolidin-3yl]-1-(4-fluorophenyl)-ethanone], a novel, potential antipsychotic with marked serotonin1A agonist properties: III. Anxiolytic actions in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1999 Mar;288(3):1002-14. | |||||
REF 34 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 35 | Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7. | |||||
REF 36 | ClinicalTrials.gov (NCT00272909) Efficacy of SUN N4057 in Subjects With Acute Ischemic Stroke and Measurable Penumbra on Magnetic Resonance Imaging (MRI). U.S. National Institutes of Health. | |||||
REF 37 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 38 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 39 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 40 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 58). | |||||
REF 41 | The serotonin 5-HT receptor agonist tandospirone improves executive function in common marmosets. Behav Brain Res. 2015 Jul 1;287:120-6. | |||||
REF 42 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | |||||
REF 43 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412) | |||||
REF 44 | ClinicalTrials.gov (NCT01774747) A Multiple Ascending Oral Dose Evaluation of the Safety, Tolerability, and Pharmacokinetics of DSP-1053 and Its Metabolites in Healthy Subjects and in Subjects With Major Depressive Disorder. U.S. National Institutes of Health. | |||||
REF 45 | ClinicalTrials.gov (NCT00664365) FTIH Study With GSK958108. U.S. National Institutes of Health. | |||||
REF 46 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 47 | Clinical pipeline report, company report or official report of SK Biopharmaceuticals. | |||||
REF 48 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698) | |||||
REF 49 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
REF 50 | mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706. | |||||
REF 51 | Caspase inhibitors: a review of recently patented compounds (2013-2015).Expert Opin Ther Pat. 2018 Jan;28(1):47-59. | |||||
REF 52 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 17). | |||||
REF 53 | Psychopathology and psychophysiology of minimal LSD-25 dosage; a preliminary dosage-response spectrum. AMA Arch Neurol Psychiatry. 1958 Feb;79(2):208-10. | |||||
REF 54 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8). | |||||
REF 55 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000679) | |||||
REF 56 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1). | |||||
REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001126) | |||||
REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001421) | |||||
REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004776) | |||||
REF 60 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014469) | |||||
REF 61 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026154) | |||||
REF 62 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001441) | |||||
REF 63 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 74). | |||||
REF 64 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010455) | |||||
REF 65 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 72). | |||||
REF 66 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006370) | |||||
REF 67 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000677) | |||||
REF 68 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422) | |||||
REF 69 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013610) | |||||
REF 70 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006909) | |||||
REF 71 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010848) | |||||
REF 72 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531) | |||||
REF 73 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001415) | |||||
REF 74 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001433) | |||||
REF 75 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002172) | |||||
REF 76 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029346) | |||||
REF 77 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002258) | |||||
REF 78 | Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32. | |||||
REF 79 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001927) | |||||
REF 80 | Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82. | |||||
REF 81 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003558) | |||||
REF 82 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 42). | |||||
REF 83 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000695) | |||||
REF 84 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 19). | |||||
REF 85 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003567) | |||||
REF 86 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430) | |||||
REF 87 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 24). | |||||
REF 88 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001368) | |||||
REF 89 | Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology & Therapeutics. 02/1999; 65(2). | |||||
REF 90 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 80). | |||||
REF 91 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002783) | |||||
REF 92 | Effects of brexpiprazole, a novel serotonin-dopamine activity modulator, on phencyclidine-induced cognitive deficits in mice: a role for serotonin 5-HT1A receptors.Pharmacol Biochem Behav.2014 Sep;124:245-9. | |||||
REF 93 | Brexpiprazole: First Global Approval.Drugs.2015 Sep;75(14):1687-97. | |||||
REF 94 | Synthesis of new derivatives of 8-OH-DPAT: Influence of substitution on the aromatic ring on the pharmacological profile, Bioorg. Med. Chem. Lett. 3(10):2035-2038 (1993). | |||||
REF 95 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 96 | Clinical pipeline report, company report or official report of GlaxoSmithKline (2009). | |||||
REF 97 | Urapidil. A reappraisal of its use in the management of hypertension. Drugs. 1998 Nov;56(5):929-55. | |||||
REF 98 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127) | |||||
REF 99 | Clinical pipeline report, company report or official report of Jazz Pharmaceuticals. | |||||
REF 100 | Pharma & Vaccines. Product Development Pipeline. April 29 2009. | |||||
REF 101 | A positron emission tomography study to assess binding of lecozotan, a novel 5-hydroxytryptamine-1A silent antagonist, to brain 5-HT1A receptors in... Clin Pharmacol Ther. 2008 Jan;83(1):86-96. | |||||
REF 102 | Dual ligands targeting dopamine D2 and serotonin 5-HT1A receptors as new antipsychotical or anti-Parkinsonian agents.Curr Med Chem.2014;21(4):437-57. | |||||
REF 103 | The discriminative stimulus effects of KA 672, a putative cognitive enhancer: evidence for a 5-HT1A component. Pharmacol Biochem Behav. 1998 Jul;60(3):703-7. | |||||
REF 104 | Company report (Minerva Neurosciences),MIN-101,Schizophrenia, 6 trials completed; Once a day formulation completed , Phase IIa completed; Phase IIb enrollment ongoing and expected to continue over the last 3 quarters of 2015. | |||||
REF 105 | Clinical pipeline report, company report or official report of Neurim Pharmaceuticals. | |||||
REF 106 | Antidepressant-like responses to the combined sigma and 5-HT1A receptor agonist OPC-14523. Neuropharmacology. 2001 Dec;41(8):976-88. | |||||
REF 107 | Antagonism of the 5-HT1A receptor stimulus in a conditioned taste aversion procedure. Eur Neuropsychopharmacol. 1999 Jun;9(4):345-9. | |||||
REF 108 | Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271 | |||||
REF 109 | EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22. | |||||
REF 110 | S 15535, a benzodioxopiperazine acting as presynaptic agonist and postsynaptic 5-HT1A receptor antagonist, prevents the impairment of spatial learning caused by intrahippocampal scopolamine. Br J Pharmacol. 1999 Nov;128(6):1207-14. | |||||
REF 111 | Labelling of recombinant human and native rat serotonin 5-HT1A receptors by a novel, selective radioligand, [3H]-S 15535: definition of its binding profile using agonists, antagonists and inverse agonists. Naunyn Schmiedebergs Arch Pharmacol. 1998 Mar;357(3):205-17. | |||||
REF 112 | DOI: 10.1038/sj.mp.4002062 | |||||
REF 113 | Experimental study of pharmacological hypothermia: enhanced neuroprotective effect of a novel 5-HT 1 A agonist SUN N4057 by the pharmacological hypothermia. No To Shinkei. 2001 Sep;53(9):853-8. | |||||
REF 114 | Company report (Fabrekramer) | |||||
REF 115 | 50 years of hurdles and hope in anxiolytic drug discovery. Nat Rev Drug Discov. 2013 Sep;12(9):667-87. | |||||
REF 116 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032503) | |||||
REF 117 | Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals. | |||||
REF 118 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412) | |||||
REF 119 | DSP-1053, a novel serotonin reuptake inhibitor with 5-HT1A partial agonistic activity, displays fast antidepressant effect with minimal undesirable effects in juvenile rats. Pharmacol Res Perspect. 2015 Jun;3(3):e00142. | |||||
REF 120 | Clinical pipeline report, company report or official report of GlaxoSmithKline. | |||||
REF 121 | In vivo electrophysiological and neurochemical effects of the selective 5-HT1A receptor agonist, F13640, at pre- and postsynaptic 5-HT1A receptors in the rat.Psychopharmacology (Berl).2012 May;221(2):261-72. | |||||
REF 122 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1). | |||||
REF 123 | SSR181507, a dopamine D receptor and 5-HT() receptor ligand: evidence for mixed anxiolytic- and antidepressant-like activities.Pharmacol Biochem Behav.2011 Jan;97(3):428-35. | |||||
REF 124 | The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96. | |||||
REF 125 | Stereoselective LSD-like activity in a series of d-lysergic acid amides of (R)- and (S)-2-aminoalkanes. J Med Chem. 1995 Mar 17;38(6):958-66. | |||||
REF 126 | Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86. | |||||
REF 127 | BMY 14802, a sigma receptor ligand for the treatment of schizophrenia. Neuropsychopharmacology. 1994 Feb;10(1):37-40. | |||||
REF 128 | The effects of BMY-14802 against L-DOPA- and dopamine agonist-induced dyskinesia in the hemiparkinsonian rat | |||||
REF 129 | Effect of sustained administration of the 5-HT1A receptor agonist flesinoxan on rat 5-HT neurotransmission. Eur Neuropsychopharmacol. 1999 Sep;9(5):427-40. | |||||
REF 130 | An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment o... J Med Chem. 2006 Jun 1;49(11):3116-35. | |||||
REF 131 | Synthesis and biological activity of the putative metabolites of the atypical antipsychotic agent tiospirone. J Med Chem. 1991 Nov;34(11):3316-28. | |||||
REF 132 | Synthesis and SAR of adatanserin: novel adamantyl aryl- and heteroarylpiperazines with dual serotonin 5-HT(1A) and 5-HT(2) activity as potential anxiolytic and antidepressant agents. J Med Chem. 1999Dec 16;42(25):5077-94. | |||||
REF 133 | Chronic alnespirone-induced desensitization of somatodendritic 5-HT1A autoreceptors in the rat dorsal raphe nucleus. Eur J Pharmacol. 1999 Jan 22;365(2-3):165-73. | |||||
REF 134 | The effects of AP521, a novel anxiolytic drug, in three anxiety models and on serotonergic neural transmission in rats. J Pharmacol Sci. 2015 Jan;127(1):109-16. | |||||
REF 135 | 5-Hydroxytryptamine1A receptor occupancy by novel full antagonist 2-[4-[4-(7-chloro-2,3-dihydro-1,4-benzdioxyn-5-yl)-1-piperazinyl]butyl]-1,2-benzisothiazol-3-(2H)-one-1,1-dioxide: a[11C][O-methyl-3H]-N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide trihydrochloride (WAY-100635) positron emission tomography study in humans. J Pharmacol Exp Ther. 2002 Jun;301(3):1144-50. | |||||
REF 136 | Effect of acute administration of the 5-HT1A receptor ligand, lesopitron, on rat cortical 5-HT and dopamine turnover. Br J Pharmacol. 1994 Oct;113(2):425-30. | |||||
REF 137 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 138 | PRX-00023, a selective serotonin 1A receptor agonist, reduces ultrasonic vocalizations in infant rats bred for high infantile anxiety.Pharmacol Biochem Behav.2009 Nov;94(1):8-15. | |||||
REF 139 | N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-nitrophenyl) cyclohexanecarboxamide: a novel pre- and postsynaptic 5-hydroxytryptamine(1A) receptor antagonist active on the lower urinary tract. JPharmacol Exp Ther. 2001 Dec;299(3):1027-37. | |||||
REF 140 | Use of PET and the radioligand [carbonyl-(11)C]WAY-100635 in psychotropic drug development. Nucl Med Biol. 2000 Jul;27(5):515-21. | |||||
REF 141 | Quantifying the 5-HT1A agonist action of buspirone in man. Psychopharmacology (Berl). 2001 Nov;158(3):224-9. | |||||
REF 142 | A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14. | |||||
REF 143 | In vitro interactions between a potential muscle relaxant E2101 and human cytochromes P450. Drug Metab Dispos. 2002 Jul;30(7):805-13. | |||||
REF 144 | The pharmacological profile of (R)-3,4-dihydro-N-isopropyl-3-(N-isopropyl-N-propylamino)-2H-1-benzopyran-5-carboxamide, a selective 5-hydroxytryptamine(1A) receptor agonist. J Pharmacol Exp Ther. 2001 Dec;299(3):883-93. | |||||
REF 145 | The use of sleep measures to compare a new 5HT1A agonist with buspirone in humans. J Psychopharmacol. 2005 Nov;19(6):609-13. | |||||
REF 146 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531) | |||||
REF 147 | Simultaneous determination of nerisopam, a novel anxiolytic agent showing polymorphic metabolism, and its N-acetyl metabolite from human plasma by a validated high performance liquid chromatographic method. J Chromatogr B Biomed Appl. 1996 Mar 29;678(1):63-72. | |||||
REF 148 | Synthesis and dual D2 and 5-HT1A receptor binding affinities of 7-piperazinyl and 7-piperidinyl-3,4-dihydroquinazolin-2(1H)-ones. Med Chem. 2014;10(5):484-96. | |||||
REF 149 | Effects of SUN 8399, a potent and selective 5-HT1A agonist, on conflict behavior and ambulatory activity in mice: comparison with those of buspirone, tandospirone and diazepam. Jpn J Pharmacol. 1994 Apr;64(4):273-80. | |||||
REF 150 | Tolerance development to the vagal-mediated bradycardia produced by 5-HT1A receptor agonists. J Pharmacol Exp Ther. 1994 Nov;271(2):776-81. | |||||
REF 151 | CN patent application no. 104151292, Indole derivative or a pharmaceutically acceptable salt thereof. | |||||
REF 152 | Cardiovascular activity of A-74283, a 5-hydroxytryptamine 1A agent, in the spontaneously hypertensive rat. Pharmacology. 1998 Jan;56(1):17-29. | |||||
REF 153 | Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43. | |||||
REF 154 | 8-[4-[2-(1,2,3,4-Tetrahydroisoquinolinyl]butyl-8-azaspiro[4.5]decane-7,9-dione: a new 5-HT1A receptor ligand with the same activity profile as busp... J Med Chem. 1996 Mar 1;39(5):1125-9. | |||||
REF 155 | Quantitative determination of CGS 18102A, a new anxiolytic, in human plasma using capillary gas chromatography/mass spectrometry. Biomed Chromatogr. 1992 Sep-Oct;6(5):244-7. | |||||
REF 156 | Synthesis, SAR and pharmacology of CP-293,019: a potent, selective dopamine D4 receptor antagonist. Bioorg Med Chem Lett. 1998 Apr 7;8(7):725-30. | |||||
REF 157 | Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82. | |||||
REF 158 | Pharmacological profile of (-)HT-90B, a novel 5-HT1A receptor agonist/5-HT2 receptor antagonist. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1201-16. | |||||
REF 159 | Chronic voluntary ethanol intake hypersensitizes 5-HT(1A) autoreceptors in C57BL/6J mice. J Neurochem. 2008 Dec;107(6):1660-70. | |||||
REF 160 | Pharmacological characterization of LY293284: A 5-HT1A receptor agonist with high potency and selectivity. J Pharmacol Exp Ther. 1994 Sep;270(3):1270-81. | |||||
REF 161 | Influence of 5-HT1A receptor antagonism on plus-maze behaviour in mice. II. WAY 100635, SDZ 216-525 and NAN-190. Pharmacol Biochem Behav. 1997 Oct;58(2):593-603. | |||||
REF 162 | Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem. 1995 Oct 13;38(21):4198-210. | |||||
REF 163 | S 14506: novel receptor coupling at 5-HT(1A) receptors. Neuropharmacology. 2001 Mar;40(3):334-44. | |||||
REF 164 | Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9. | |||||
REF 165 | Pharmacological characterization of recombinant human 5-hydroxytryptamine1A receptors using a novel antagonist radioligand, [3H]WAY-100635. Life Sci. 1997;60(9):653-65. | |||||
REF 166 | Cocaine and serotonin: a role for the 5-HT(1A) receptor site in the mediation of cocaine stimulant effects. Behav Brain Res. 2001 Nov 29;126(1-2):127-33. | |||||
REF 167 | Involvement of 5-hydroxytryptamine(1A) receptors in nicotine-induced tail tremor in rats. Eur J Pharmacol. 2000 Nov 10;408(1):19-23. | |||||
REF 168 | Synthesis of (R,S)-trans-8-hydroxy-2-[N-n-propyl-N-(3'-iodo-2'-propenyl)amino]tetral in (trans-8-OH-PIPAT): a new 5-HT1A receptor ligand. J Med Chem. 1993 Oct 15;36(21):3161-5. | |||||
REF 169 | Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. J Med Chem. 1986 May;29(5):630-4. | |||||
REF 170 | R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. | |||||
REF 171 | Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. Bioorg Med Chem. 2008 Jul 15;16(14):6675-81. | |||||
REF 172 | The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl). 2001 Aug;157(1):111-4. | |||||
REF 173 | 5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. J Med Chem. 1986 Nov;29(11):2375-80. | |||||
REF 174 | Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7. | |||||
REF 175 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28. | |||||
REF 176 | 5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. J Med Chem. 1986 Feb;29(2):194-9. | |||||
REF 177 | Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7. | |||||
REF 178 | Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7. | |||||
REF 179 | Activity of aromatic substituted phenylpiperazines lacking affinity for dopamine binding sites in a preclinical test of antipsychotic efficacy. J Med Chem. 1989 May;32(5):1052-6. | |||||
REF 180 | Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. J Med Chem. 1991 Jun;34(6):1850-4. | |||||
REF 181 | Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new ... J Med Chem. 1994 Aug 19;37(17):2754-60. | |||||
REF 182 | Identification of a red-emitting fluorescent ligand for in vitro visualization of human serotonin 5-HT(1A) receptors. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6628-32. | |||||
REF 183 | The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. | |||||
REF 184 | 5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. J Med Chem. 1997 Nov 21;40(24):3974-8. | |||||
REF 185 | Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. J Med Chem. 2006 Nov 2;49(22):6607-13. | |||||
REF 186 | Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem. 2005 Jan 13;48(1):266-73. | |||||
REF 187 | Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31. | |||||
REF 188 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | |||||
REF 189 | Novel aminoethylbiphenyls as 5-HT7 receptor ligands. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3018-22. | |||||
REF 190 | SAR studies on new bis-aryls 5-HT7 ligands: Synthesis and molecular modeling. Bioorg Med Chem. 2010 Mar 1;18(5):1958-67. | |||||
REF 191 | 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997). | |||||
REF 192 | A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem. 2003 Sep 11;46(19):4188-95. | |||||
REF 193 | 3-(1,2,5,6-Tetrahydropyrid-4-yl)pyrrolo[3,2-b]pyrid-5-one: a potent and selective serotonin (5-HT1B) agonist and rotationally restricted phenolic a... J Med Chem. 1990 Aug;33(8):2087-93. | |||||
REF 194 | New generation dopaminergic agents. 2. Discovery of 3-OH-phenoxyethylamine and 3-OH-N1-phenylpiperazine dopaminergic templates. Bioorg Med Chem Lett. 1998 Feb 3;8(3):295-300. | |||||
REF 195 | 6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. J Med Chem. 1992 Oct 30;35(22):3984-90. | |||||
REF 196 | Indoloxypropanolamine analogues as 5-HT(1A) receptor antagonists. Bioorg Med Chem Lett. 2007 Oct 15;17(20):5600-4. | |||||
REF 197 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 198 | Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. | |||||
REF 199 | Agonist activity of antimigraine drugs at recombinant human 5-HT1A receptors: potential implications for prophylactic and acute therapy. Naunyn Schmiedebergs Arch Pharmacol. 1997 Jun;355(6):682-8. | |||||
REF 200 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | |||||
REF 201 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 202 | Ergolines as selective 5-HT1 agonists. J Med Chem. 1988 Aug;31(8):1512-9. | |||||
REF 203 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | |||||
REF 204 | WO patent application no. 2012,0025,83, Method for treating schizophrenia and related diseases with a combination therapy. | |||||
REF 205 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | |||||
REF 206 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | |||||
REF 207 | Diagnosis of migraine with aura, depression and anxiety from allelic variations in dopaminergic genes | |||||
REF 208 | Alkaloids from Eschscholzia californica and their capacity to inhibit binding of [3H]8-Hydroxy-2-(di-N-propylamino)tetralin to 5-HT1A receptors in ... J Nat Prod. 2006 Mar;69(3):432-5. | |||||
REF 209 | Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-... J Med Chem. 1985 Oct;28(10):1540-2. | |||||
REF 210 | Agonist and antagonist actions of antipsychotic agents at 5-HT1A receptors: a [35S]GTPgammaS binding study. Eur J Pharmacol. 1998 Aug 21;355(2-3):245-56. | |||||
REF 211 | Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69. | |||||
REF 212 | 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001. | |||||
REF 213 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. | |||||
REF 214 | Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22. | |||||
REF 215 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | |||||
REF 216 | Arylpiperazine derivatives as high-affinity 5-HT1A serotonin ligands. J Med Chem. 1988 Oct;31(10):1968-71. | |||||
REF 217 | p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90. | |||||
REF 218 | A 18F-MPPF PET normative database of 5-HT1A receptor binding in men and women over aging. J Nucl Med. 2005 Dec;46(12):1980-9. | |||||
REF 219 | New sigma and 5-HT1A receptor ligands: omega-(tetralin-1-yl)-n-alkylamine derivatives. J Med Chem. 1996 Jan 5;39(1):176-82. | |||||
REF 220 | Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46. | |||||
REF 221 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | |||||
REF 222 | Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characteri... J Med Chem. 2009 Nov 12;52(21):6946-50. | |||||
REF 223 | Characterization of the aminomethylchroman derivative BAY x 3702 as a highly potent 5-hydroxytryptamine1A receptor agonist. J Pharmacol Exp Ther. 1998 Mar;284(3):1082-94. | |||||
REF 224 | Interaction of the anxiogenic agent, RS-30199, with 5-HT1A receptors: modulation of sexual activity in the male rat. Neuropharmacology. 1998 Jun;37(6):769-80. | |||||
REF 225 | SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806. | |||||
REF 226 | Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80. | |||||
REF 227 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 228 | Novel 3-aminochromans as potential pharmacological tools for the serotonin 5-HT(7) receptor. Bioorg Med Chem Lett. 2005 Feb 1;15(3):747-50. | |||||
REF 229 | Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione ... J Med Chem. 2005 Apr 21;48(8):3076-9. | |||||
REF 230 | Effect of SR 59026A, a new 5-HT(1A) receptor agonist, on sexual activity in male rats. Behav Pharmacol. 1995 Apr;6(3):276-282. | |||||
REF 231 | Characterization of U-92016A as a selective, orally active, high intrinsic activity 5-hydroxytryptamine1A agonist. J Pharmacol Exp Ther. 1994 Nov;271(2):875-83. | |||||
REF 232 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | |||||
REF 233 | N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7. | |||||
REF 234 | Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6. | |||||
REF 235 | [11C]-WAY100635 PET demonstrates marked 5-HT1A receptor changes in sporadic ALS. Brain. 2005 Apr;128(Pt 4):896-905. | |||||
REF 236 | Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10. | |||||
REF 237 | [(3)H]-F13640, a novel, selective and high-efficacy serotonin 5-HT(1A) receptor agonist radioligand. Naunyn Schmiedebergs Arch Pharmacol. 2010 Oct;382(4):321-30. | |||||
REF 238 | Ligand binding characteristics of the human serotonin1A receptor heterologously expressed in CHO cells. Biosci Rep. 2004 Apr;24(2):101-15. | |||||
REF 239 | Receptor binding characteristics of [3H]NAD-299, a new selective 5-HT1A receptor antagonist. Eur J Pharmacol. 1998 Nov 6;360(2-3):219-25. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.