Target General Infomation
Target ID
T91696 (Former ID: TTDC00012)
Target Name
Fibronectin (FN1)
Synonyms
FN; Cold-insoluble globulin; CIG
Gene Name
FN1
Target Type
Clinical trial target
[1]
Disease [+] 1 Target-related Diseases +
1 Vitreous body disorder [ICD-11: 9B8Z]
Function
Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.
BioChemical Class
Fibronectin protein
UniProt ID
FINC_HUMAN
Sequence
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSD
NAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIA
PRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLL
IGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISV
KWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGE
SQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSA
QWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLT
SRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRT
IKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLL
VSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQ
KSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTS
GQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP
HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLT
GLTRGATYNVIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDE
WERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLG
NGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEP
SPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Ocriplasmin Drug Info Approved Symptomatic vitreomacular adhesion [2], [3]
Clinical Trial Drug(s) [+] 1 Clinical Trial Drugs +
1 L19-TNF-alpha Drug Info Phase 2 Colorectal cancer [4]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 1 Inhibitor drugs +
1 Ocriplasmin Drug Info [3]
Target Regulators
Target-regulating microRNAs
Target-regulating Transcription Factors
Target-interacting Proteins
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 9 KEGG Pathways +
1 PI3K-Akt signaling pathway
2 Focal adhesion
3 ECM-receptor interaction
4 Regulation of actin cytoskeleton
5 Bacterial invasion of epithelial cells
6 Amoebiasis
7 Pathways in cancer
8 Proteoglycans in cancer
9 Small cell lung cancer
NetPath Pathway [+] 2 NetPath Pathways +
1 IL4 Signaling Pathway
2 TGF_beta_Receptor Signaling Pathway
Panther Pathway [+] 1 Panther Pathways +
1 Integrin signalling pathway
PID Pathway [+] 11 PID Pathways +
1 Beta1 integrin cell surface interactions
2 Beta3 integrin cell surface interactions
3 Angiopoietin receptor Tie2-mediated signaling
4 Alpha9 beta1 integrin signaling events
5 Integrins in angiogenesis
6 Syndecan-4-mediated signaling events
7 Urokinase-type plasminogen activator (uPA) and uPAR-mediated signaling
8 Beta5 beta6 beta7 and beta8 integrin cell surface interactions
9 Syndecan-2-mediated signaling events
10 VEGFR3 signaling in lymphatic endothelium
11 Alpha4 beta1 integrin signaling events
Reactome [+] 13 Reactome Pathways +
1 Platelet degranulation
2 Degradation of the extracellular matrix
3 Fibronectin matrix formation
4 Cell surface interactions at the vascular wall
5 Molecules associated with elastic fibres
6 Integrin cell surface interactions
7 Syndecan interactions
8 Non-integrin membrane-ECM interactions
9 ECM proteoglycans
10 Integrin alphaIIb beta3 signaling
11 GRB2:SOS provides linkage to MAPK signaling for Integrins
12 p130Cas linkage to MAPK signaling for integrins
13 MAP2K and MAPK activation
WikiPathways [+] 11 WikiPathways +
1 Senescence and Autophagy in Cancer
2 Regulation of Actin Cytoskeleton
3 Inflammatory Response Pathway
4 TGF beta Signaling Pathway
5 Focal Adhesion
6 miRNA targets in ECM and membrane receptors
7 Extracellular matrix organization
8 Nanoparticle-mediated activation of receptor signaling
9 Integrin cell surface interactions
10 Integrin alphaIIb beta3 signaling
11 Cell surface interactions at the vascular wall
Target-Related Models and Studies
Target Validation
References
REF 1 National Cancer Institute Drug Dictionary (drug id 686947).
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7446).
REF 3 Nat Rev Drug Discov. 2013 Feb;12(2):87-90.
REF 4 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026493)

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.