Target General Infomation
Target ID
T97765 (Former ID: TTDR00921)
Target Name
Macrophage inflammatory protein 1-alpha (CCL3)
Synonyms
Tonsillar lymphocyte LD78 alpha protein; Small-inducible cytokine A3; SIS-beta; SCYA3; PAT 464.1; Macrophage Inflammatory Protein-1alpha Nuclear Protein; MNP; MIP1A; MIP-1-alpha; G0S19-1 protein; G0S19-1; G0/G1 switch regulatory protein 19-1; C-C motif chemokine 3
Gene Name
CCL3
Target Type
Clinical trial target
[1]
Disease [+] 1 Target-related Diseases +
1 Transplanted organ/tissue [ICD-11: QB63]
Function
Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Monokine with inflammatory and chemokinetic properties.
BioChemical Class
Cytokine: CC chemokine
UniProt ID
CCL3_HUMAN
Sequence
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 1 Clinical Trial Drugs +
1 Nagrestipen Drug Info Phase 1 Bone marrow transplantation [1]
Mode of Action [+] 1 Modes of Action +
Modulator [+] 1 Modulator drugs +
1 Nagrestipen Drug Info [1]
Target Regulators
Target-regulating microRNAs
Target Affiliated Biological Pathways
KEGG Pathway [+] 6 KEGG Pathways +
1 Cytokine-cytokine receptor interaction
2 Chemokine signaling pathway
3 Toll-like receptor signaling pathway
4 Salmonella infection
5 Chagas disease (American trypanosomiasis)
6 Rheumatoid arthritis
NetPath Pathway [+] 6 NetPath Pathways +
1 IL9 Signaling Pathway
2 IL5 Signaling Pathway
3 IL2 Signaling Pathway
4 TWEAK Signaling Pathway
5 RANKL Signaling Pathway
6 TCR Signaling Pathway
Panther Pathway [+] 1 Panther Pathways +
1 Inflammation mediated by chemokine and cytokine signaling pathway
PID Pathway [+] 1 PID Pathways +
1 IL12-mediated signaling events
Reactome [+] 1 Reactome Pathways +
1 Chemokine receptors bind chemokines
WikiPathways [+] 4 WikiPathways +
1 Toll-like receptor signaling pathway
2 Senescence and Autophagy in Cancer
3 GPCR ligand binding
4 Regulation of toll-like receptor signaling pathway
References
REF 1 Macrophage inflammatory protein derivative ECI301 enhances the alarmin-associated abscopal benefits of tumor radiotherapy. Cancer Res. 2014 Sep 15;74(18):5070-8.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.