Target General Infomation
Target ID
T99704
Target Name
V-set immunoregulatory receptor (VSIR)
Synonyms
VISTA; V-set domain-containing immunoregulatory receptor; Stress-induced secreted protein-1; Sisp-1; SISP1; Platelet receptor Gi24; C10orf54
Gene Name
VSIR
Target Type
Clinical trial target
[1]
Disease [+] 2 Target-related Diseases +
1 Lymphoma [ICD-11: 2A80-2A86]
2 Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Function
Immunoregulatory receptor which inhibits the T-cell response (PubMed:24691993). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. May stimulate MMP14-mediated MMP2 activation (PubMed:20666777).
UniProt ID
VISTA_HUMAN
Sequence
MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPV
DKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
SASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVV
YPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGI
ENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLD
PVPDSPNFEVI
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 2 Clinical Trial Drugs +
1 CA-170 Drug Info Phase 1 Lymphoma [2]
2 JNJ-61610588 Drug Info Phase 1 Solid tumour/cancer [1]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 2 Inhibitor drugs +
1 CA-170 Drug Info [3]
2 JNJ-61610588 Drug Info [1]
Target Affiliated Biological Pathways
KEGG Pathway [+] 1 KEGG Pathways +
1 Cell adhesion molecules (CAMs)
References
REF 1 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 2 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 3 Development of Inhibitors of the Programmed Cell Death-1/Programmed Cell Death-Ligand 1 Signaling Pathway.J Med Chem. 2019 Feb 28;62(4):1715-1730.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.