Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T00033
(Former ID: TTDR00181)
|
|||||
| Target Name |
Transforming growth factor alpha (TGFA)
|
|||||
| Synonyms |
TGF-alpha (40-89); TGF type 1 (40-89); Protransforming growth factor alpha (40-89); ETGF (40-89); EGF-like TGF (40-89)
|
|||||
| Gene Name |
TGFA
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Chronic kidney disease [ICD-11: GB61] | |||||
| Function |
TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Click to Show/Hide
|
|||||
| BioChemical Class |
Growth factor
|
|||||
| UniProt ID | ||||||
| Sequence |
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | LY3016859 | Drug Info | Phase 1/2 | Chronic kidney disease | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | LY3016859 | Drug Info | [1] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | COPII (Coat Protein 2) Mediated Vesicle Transport | |||||
| 2 | Cargo concentration in the ER | |||||
| WikiPathways | [+] 4 WikiPathways | + | ||||
| 1 | ErbB Signaling Pathway | |||||
| 2 | NRF2 pathway | |||||
| 3 | Nuclear Receptors Meta-Pathway | |||||
| 4 | Extracellular vesicle-mediated signaling in recipient cells | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Generation and activity of a humanized monoclonal antibody that selectively neutralizes the epidermal growth factor receptor ligands transforming growth factor-alpha and epiregulin. J Pharmacol Exp Ther. 2014 May;349(2):330-43. | |||||
| REF 2 | ClinicalTrials.gov (NCT01774981) Study of LY3016859 in Participants With Diabetic Nephropathy. U.S. National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.