Target General Infomation
Target ID
T00099
Target Name
HUMAN calpain-1/calpain small subunit 1 heterodimer (CAPN1/CAPNS1)
Synonyms
Calpain-1 large subunit/calpain small subunit 1 dimer
Disease [+] 1 Target-related Diseases +
1 COVID-19 [ICD-11: 1D6Y]
Function
Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
BioChemical Class
Peptidase C2 family
UniProt ID
CAN1_HUMAN/CPNS1_HUMAN
Sequence
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Drugs and Modes of Action
Drugs in Phase 2 Trial [+] 1 +
1 BLD-2660 Drug Info Phase 2 Coronavirus Disease 2019 (COVID-19) [1]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 1 Inhibitor drugs +
1 BLD-2660 Drug Info [1], [2]
References
REF 1 ClinicalTrials.gov (NCT04334460) Safety and Antiviral Activity of BLD-2660 in COVID-19 Hospitalized Subjects. U.S. National Institutes of Health.
REF 2 Blade is a leader in repairing tissue fibrosis and organ dysfunction

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.