Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T00523
(Former ID: TTDI01558)
|
|||||
Target Name |
Glucose transporter type 9 (GLUT9)
|
|||||
Synonyms |
Urate transporter; Solute carrier family 2, facilitated glucose transporter member 9; GLUT9; GLUT-9
Click to Show/Hide
|
|||||
Gene Name |
SLC2A9
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Gout [ICD-11: FA25] | |||||
Function |
Urate transporter, which may play a role in the urate reabsorption by proximal tubules. Does not transport glucose, fructose or galactose.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVAS
LAGAFGSSFLYGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIG GLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGV ALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGLPELLGKESTWPYLFGVIVV PAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIR LVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLST GGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTLQDHAPWVPYLSIVGIL AIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYC FLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T48D74 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | SAP-001 | Drug Info | Phase 2 | Gout | [2] | |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | AA-193 | Drug Info | Discontinued in Phase 2 | Hyperuricaemia | [3] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | SAP-001 | Drug Info | [4] | |||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | AA-193 | Drug Info | [1] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
Protein Name | Pfam ID | Percentage of Identity (%) | E value |
---|---|---|---|
Solute carrier family 22 member 7 (SLC22A7) | 24.332 (82/337) | 3.56E-07 | |
Organic cation transporter 3 (OCT3) | 23.789 (54/227) | 1.53E-04 |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Uricosurics inhibit urate transporter in rat renal brush border membrane vesicles. Eur J Pharmacol. 1990 Oct 23;187(3):303-12. | |||||
REF 2 | ClinicalTrials.gov (NCT05690204) A Phase 2B Study to Evaluate the Efficacy and Safety in Combination With Standard of Care in Adult Subjects With Gout, and Hyperuricemia Refractory to Conventional XOI Therapy. U.S.National Institutes of Health. | |||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003058) | |||||
REF 4 | Clinical pipeline report, company report or official report of Shanton Pharma Shanghai, China |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.