Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T10735
(Former ID: TTDC00027)
|
||||
Target Name |
Histidine decarboxylase (HDC)
|
||||
Synonyms |
Human histidine decarboxylase
|
||||
Gene Name |
HDC
|
||||
Target Type |
Clinical trial target
|
[1] | |||
Disease | [+] 1 Target-related Diseases | + | |||
1 | Hypo-osmolality/hyponatraemia [ICD-11: 5C72] | ||||
Function |
Catalyzes the biosynthesis of histamine from histidine.
|
||||
BioChemical Class |
Carbon-carbon lyase
|
||||
UniProt ID | |||||
EC Number |
EC 4.1.1.22
|
||||
Sequence |
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESC LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVF VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCT SQPSPRVGNLISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGL HLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPT EASVKNGGSSRVRIFSRFPEDMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA MV |
||||
Drugs and Modes of Action | |||||
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | |||
1 | Lixivaptan | Drug Info | Phase 3 | Hyponatraemia | [2], [3] |
2 | ALPHA-FMH | Drug Info | Phase 1 | Pruritus | [4] |
Mode of Action | [+] 2 Modes of Action | + | |||
Inhibitor | [+] 3 Inhibitor drugs | + | |||
1 | Lixivaptan | Drug Info | [1] | ||
2 | AMA | Drug Info | [6] | ||
3 | Brocresine | Drug Info | [7], [8] | ||
Modulator | [+] 1 Modulator drugs | + | |||
1 | ALPHA-FMH | Drug Info | [5] | ||
Target Regulators | |||||
Target-regulating Transcription Factors | |||||
Target Profiles in Patients | |||||
Target Expression Profile (TEP) | |||||
Target Affiliated Biological Pathways | |||||
KEGG Pathway | [+] 2 KEGG Pathways | + | |||
1 | Histidine metabolism | ||||
2 | Metabolic pathways | ||||
Panther Pathway | [+] 2 Panther Pathways | + | |||
1 | Histamine synthesis | ||||
2 | CCKR signaling map ST | ||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | |||
1 | Histidine Metabolism | ||||
WikiPathways | [+] 2 WikiPathways | + | |||
1 | Biogenic Amine Synthesis | ||||
2 | Metabolism of amino acids and derivatives | ||||
Target-Related Models and Studies | |||||
Target Validation | |||||
References | |||||
REF 1 | Clinical pipeline report, company report or official report of Biofrontera (2009). | ||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2238). | ||||
REF 3 | Physical state of kappa-carrageenan modulates the mode of action of kappa-carrageenase from Pseudoalteromonas carrageenovora. Biochem J. 2009 May 1;419(3):545-53. | ||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5189). | ||||
REF 5 | Alpha-Fluoromethylhistidine. Kinetics of uptake and inhibition of histamine synthesis in basophil (2H3) cell cultures. Mol Pharmacol. 1985 Aug;28(2):191-9. | ||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1274). | ||||
REF 7 | Histamine in brain--its role in regulation of seizure susceptibility. Epilepsy Res. 1991 Nov-Dec;10(2-3):111-8. | ||||
REF 8 | Effects of brocresine (NSD-1055) and cycloheximide on amino acid decarboxylase activities in gastric mucosa of normal and vagally denervated rats. Br J Pharmacol. 1972 Dec;46(4):688-95. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.