Target General Infomation
Target ID
T10735 (Former ID: TTDC00027)
Target Name
Histidine decarboxylase (HDC)
Synonyms
Human histidine decarboxylase
Gene Name
HDC
Target Type
Clinical trial target
[1]
Disease [+] 1 Target-related Diseases +
1 Hypo-osmolality/hyponatraemia [ICD-11: 5C72]
Function
Catalyzes the biosynthesis of histamine from histidine.
BioChemical Class
Carbon-carbon lyase
UniProt ID
DCHS_HUMAN
EC Number
EC 4.1.1.22
Sequence
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESC
LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVF
VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT
ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCT
SQPSPRVGNLISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGL
HLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPT
EASVKNGGSSRVRIFSRFPEDMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA
MV
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 2 Clinical Trial Drugs +
1 Lixivaptan Drug Info Phase 3 Hyponatraemia [2], [3]
2 ALPHA-FMH Drug Info Phase 1 Pruritus [4]
Mode of Action [+] 2 Modes of Action +
Inhibitor [+] 3 Inhibitor drugs +
1 Lixivaptan Drug Info [1]
2 AMA Drug Info [6]
3 Brocresine Drug Info [7], [8]
Modulator [+] 1 Modulator drugs +
1 ALPHA-FMH Drug Info [5]
Target Regulators
Target-regulating Transcription Factors
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 2 KEGG Pathways +
1 Histidine metabolism
2 Metabolic pathways
Panther Pathway [+] 2 Panther Pathways +
1 Histamine synthesis
2 CCKR signaling map ST
Pathwhiz Pathway [+] 1 Pathwhiz Pathways +
1 Histidine Metabolism
WikiPathways [+] 2 WikiPathways +
1 Biogenic Amine Synthesis
2 Metabolism of amino acids and derivatives
Target-Related Models and Studies
Target Validation
References
REF 1 Clinical pipeline report, company report or official report of Biofrontera (2009).
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2238).
REF 3 Physical state of kappa-carrageenan modulates the mode of action of kappa-carrageenase from Pseudoalteromonas carrageenovora. Biochem J. 2009 May 1;419(3):545-53.
REF 4 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5189).
REF 5 Alpha-Fluoromethylhistidine. Kinetics of uptake and inhibition of histamine synthesis in basophil (2H3) cell cultures. Mol Pharmacol. 1985 Aug;28(2):191-9.
REF 6 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1274).
REF 7 Histamine in brain--its role in regulation of seizure susceptibility. Epilepsy Res. 1991 Nov-Dec;10(2-3):111-8.
REF 8 Effects of brocresine (NSD-1055) and cycloheximide on amino acid decarboxylase activities in gastric mucosa of normal and vagally denervated rats. Br J Pharmacol. 1972 Dec;46(4):688-95.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.