Target General Infomation
Target ID
T10877 (Former ID: TTDNC00424)
Target Name
Cyclic ADP-ribose hydrolase 1 (CD38)
Synonyms
cADPr hydrolase 1; T10; Cyclic ADPribose hydrolase 1; ADPribosyl cyclase 1; ADPRC 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; ADP-ribosyl cyclase 1; 2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-ADP-ribosyl cyclase
Gene Name
CD38
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Multiple myeloma [ICD-11: 2A83]
Function
Has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system. Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion.
BioChemical Class
Glycosylase
UniProt ID
CD38_HUMAN
EC Number
EC 3.2.2.6
Sequence
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Daratumumab Drug Info Approved Multiple myeloma [2], [3], [4]
Clinical Trial Drug(s) [+] 11 Clinical Trial Drugs +
1 4SCAR19 and 4SCAR38 Drug Info Phase 1/2 B-cell lymphoma [5]
2 Anti-CD38 CAR-T cells Drug Info Phase 1/2 Multiple myeloma [6]
3 CD38 and BCMA CAR-T Cells Drug Info Phase 1/2 Multiple myeloma [7]
4 CD38 CAR T cells Drug Info Phase 1/2 Multiple myeloma [8]
5 CD38 CAR-T Cell Drug Info Phase 1/2 Acute lymphoblastic leukaemia [9]
6 CD38-specific gene-engineered T cells Drug Info Phase 1/2 Acute myeloid leukaemia [10]
7 MOR-202 Drug Info Phase 1/2 Multiple myeloma [11]
8 SAR-650984 Drug Info Phase 1/2 Haematological malignancy [12]
9 Anti-CD38 CAR-T cells Drug Info Phase 1 Multiple myeloma [13]
10 CART-38 cells Drug Info Phase 1 Myelodysplastic syndrome [14]
11 CAR-T cells targeting CD38 Drug Info Clinical trial Multiple myeloma [15]
Mode of Action [+] 3 Modes of Action +
CAR-T-Cell-Therapy(Dual specific) [+] 2 CAR-T-Cell-Therapy(Dual specific) drugs +
1 4SCAR19 and 4SCAR38 Drug Info [5]
2 CD38 and BCMA CAR-T Cells Drug Info [7]
CAR-T-Cell-Therapy [+] 7 CAR-T-Cell-Therapy drugs +
1 Anti-CD38 CAR-T cells Drug Info [6]
2 CD38 CAR T cells Drug Info [8]
3 CD38 CAR-T Cell Drug Info [9]
4 CD38-specific gene-engineered T cells Drug Info [10]
5 Anti-CD38 CAR-T cells Drug Info [13]
6 CART-38 cells Drug Info [14]
7 CAR-T cells targeting CD38 Drug Info [15], [18]
Modulator [+] 1 Modulator drugs +
1 HuMax-CD38b Drug Info [19]
Target Regulators
Target-regulating microRNAs
Target-interacting Proteins
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 8 KEGG Pathways +
1 Nicotinate and nicotinamide metabolism
2 Metabolic pathways
3 Calcium signaling pathway
4 Hematopoietic cell lineage
5 Oxytocin signaling pathway
6 Salivary secretion
7 Pancreatic secretion
8 Epstein-Barr virus infection
NetPath Pathway [+] 2 NetPath Pathways +
1 Leptin Signaling Pathway
2 TCR Signaling Pathway
Panther Pathway [+] 1 Panther Pathways +
1 CCKR signaling map ST
WikiPathways [+] 1 WikiPathways +
1 Oxytocin signaling
References
REF 1 Targeting CD38 with Daratumumab Monotherapy in Multiple Myeloma. N Engl J Med. 2015 Sep 24;373(13):1207-19.
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7395).
REF 3 ClinicalTrials.gov (NCT02252172) Study Comparing Daratumumab, Lenalidomide, and Dexamethasone With Lenalidomide and Dexamethasone in Participants With Previously Untreated Multiple Myeloma. U.S. National Institutes of Health.
REF 4 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 5 ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
REF 6 ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
REF 7 ClinicalTrials.gov (NCT03767751) A Feasibility and Safety Study of Dual Specificity CD38 and BCMA CAR-T Cell Immunotherapy for Relapsed or Refractory Multiple Myeloma
REF 8 ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma
REF 9 ClinicalTrials.gov (NCT03754764) A Feasibility and Safety Study of CD38 CAR-T Cell Immunotherapy for Relapsed B-cell Acute Lymphoblastic Leukemia After CD19 CAR-T Adoptive Cellular Immunotherapy
REF 10 ClinicalTrials.gov (NCT03222674) Multi-CAR T Cell Therapy for Acute Myeloid Leukemia
REF 11 ClinicalTrials.gov (NCT01421186) A Phase I/IIa Study of Human Anti-CD38 Antibody MOR03087 (MOR202) in Relapsed/Refractory Multiple Myeloma. U.S. National Institutes of Health.
REF 12 ClinicalTrials.gov (NCT01084252) Phase 1/2 Dose Escalation and Efficacy Study of Anti-CD38 Monoclonal Antibody in Patients With Selected CD38+ Hematological Malignancies. U.S. National Institutes of Health.
REF 13 ClinicalTrials.gov (NCT03464916) Study to Evaluate the Safety and Efficacy of Anti-CD38 CAR-T in Relapsed or Refractory Multiple Myeloma Patients
REF 14 ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
REF 15 ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma
REF 16 Clinical pipeline report, company report or official report of MorphoSys.
REF 17 Clinical pipeline report, company report or official report of Sanofi-Aventis.
REF 18 ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia
REF 19 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2766).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.