Target General Infomation
Target ID
T13017 (Former ID: TTDI02170)
Target Name
Syndecan-1 (SDC1)
Synonyms
SYND1; SDC; CD138
Gene Name
SDC1
Target Type
Clinical trial target
[1]
Disease [+] 2 Target-related Diseases +
1 Multiple myeloma [ICD-11: 2A83]
2 Immune system disease [ICD-11: 4A01-4B41]
Function
Regulates exosome biogenesis in concert with SDCBP and PDCD6IP. Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
BioChemical Class
Peptide translocating syndecan
UniProt ID
SDC1_HUMAN
Sequence
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEFYA
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 6 Clinical Trial Drugs +
1 BT-062 Drug Info Phase 2 Multiple myeloma [2], [3]
2 CART-138 cells Drug Info Phase 1/2 Multiple myeloma [4]
3 CART-138 cells Drug Info Phase 1/2 Multiple myeloma [5]
4 CD138 CAR T cells Drug Info Phase 1/2 Multiple myeloma [6]
5 CAR138 T Cells Drug Info Phase 1 Immune System disease [7]
6 CAR-T cells targeting CD138 Drug Info Clinical trial Multiple myeloma [8]
Mode of Action [+] 1 Modes of Action +
CAR-T-Cell-Therapy [+] 5 CAR-T-Cell-Therapy drugs +
1 CART-138 cells Drug Info [4]
2 CART-138 cells Drug Info [5]
3 CD138 CAR T cells Drug Info [6]
4 CAR138 T Cells Drug Info [7]
5 CAR-T cells targeting CD138 Drug Info [8]
Target Regulators
Target-regulating microRNAs
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
PID Pathway [+] 5 PID Pathways +
1 Beta3 integrin cell surface interactions
2 Integrins in angiogenesis
3 Proteoglycan syndecan-mediated signaling events
4 Syndecan-1-mediated signaling events
5 Beta5 beta6 beta7 and beta8 integrin cell surface interactions
References
REF 1 The monoclonal antibody nBT062 conjugated to cytotoxic Maytansinoids has selective cytotoxicity against CD138-positive multiple myeloma cells in vitro and in vivo. Clin Cancer Res. 2009 Jun 15;15(12):4028-37.
REF 2 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 4 ClinicalTrials.gov (NCT01886976) Treatment of Chemotherapy Refractory Multiple Myeloma by CART-138
REF 5 ClinicalTrials.gov (NCT03196414) Study of CART-138/BCMA Therapy for R/R Multiple Myeloma
REF 6 ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma
REF 7 ClinicalTrials.gov (NCT03672318) Study of ATLCAR.CD138 Cells for Relapsed/Refractory Multiple Myeloma
REF 8 ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.