Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T13017
(Former ID: TTDI02170)
|
||||
| Target Name |
Syndecan-1 (SDC1)
|
||||
| Synonyms |
SYND1; SDC; CD138
|
||||
| Gene Name |
SDC1
|
||||
| Target Type |
Clinical trial target
|
[1] | |||
| Disease | [+] 2 Target-related Diseases | + | |||
| 1 | Multiple myeloma [ICD-11: 2A83] | ||||
| 2 | Immune system disease [ICD-11: 4A01-4B41] | ||||
| Function |
Regulates exosome biogenesis in concert with SDCBP and PDCD6IP. Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
|
||||
| BioChemical Class |
Peptide translocating syndecan
|
||||
| UniProt ID | |||||
| Sequence |
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ KPTKQEEFYA |
||||
| Drugs and Modes of Action | |||||
| Clinical Trial Drug(s) | [+] 6 Clinical Trial Drugs | + | |||
| 1 | BT-062 | Drug Info | Phase 2 | Multiple myeloma | [2], [3] |
| 2 | CART-138 cells | Drug Info | Phase 1/2 | Multiple myeloma | [4] |
| 3 | CART-138 cells | Drug Info | Phase 1/2 | Multiple myeloma | [5] |
| 4 | CD138 CAR T cells | Drug Info | Phase 1/2 | Multiple myeloma | [6] |
| 5 | CAR138 T Cells | Drug Info | Phase 1 | Immune System disease | [7] |
| 6 | CAR-T cells targeting CD138 | Drug Info | Clinical trial | Multiple myeloma | [8] |
| Mode of Action | [+] 1 Modes of Action | + | |||
| CAR-T-Cell-Therapy | [+] 5 CAR-T-Cell-Therapy drugs | + | |||
| 1 | CART-138 cells | Drug Info | [4] | ||
| 2 | CART-138 cells | Drug Info | [5] | ||
| 3 | CD138 CAR T cells | Drug Info | [6] | ||
| 4 | CAR138 T Cells | Drug Info | [7] | ||
| 5 | CAR-T cells targeting CD138 | Drug Info | [8] | ||
| Target Regulators | |||||
| Target-regulating microRNAs | |||||
| Target Profiles in Patients | |||||
| Target Expression Profile (TEP) | |||||
| Target Affiliated Biological Pathways | |||||
| PID Pathway | [+] 5 PID Pathways | + | |||
| 1 | Beta3 integrin cell surface interactions | ||||
| 2 | Integrins in angiogenesis | ||||
| 3 | Proteoglycan syndecan-mediated signaling events | ||||
| 4 | Syndecan-1-mediated signaling events | ||||
| 5 | Beta5 beta6 beta7 and beta8 integrin cell surface interactions | ||||
| References | |||||
| REF 1 | The monoclonal antibody nBT062 conjugated to cytotoxic Maytansinoids has selective cytotoxicity against CD138-positive multiple myeloma cells in vitro and in vivo. Clin Cancer Res. 2009 Jun 15;15(12):4028-37. | ||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | ||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | ||||
| REF 4 | ClinicalTrials.gov (NCT01886976) Treatment of Chemotherapy Refractory Multiple Myeloma by CART-138 | ||||
| REF 5 | ClinicalTrials.gov (NCT03196414) Study of CART-138/BCMA Therapy for R/R Multiple Myeloma | ||||
| REF 6 | ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma | ||||
| REF 7 | ClinicalTrials.gov (NCT03672318) Study of ATLCAR.CD138 Cells for Relapsed/Refractory Multiple Myeloma | ||||
| REF 8 | ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.