Target General Infomation
Target ID
T13629
Target Name
PD-1-PD-L1 interaction (PD-1/PD-L1 PPI)
Synonyms
Programmed cell death 1/Programmed cell death 1 ligand 1 PPI
Gene Name
PDCD1-CD274
Target Type
Patented-recorded target
[1]
Disease [+] 4 Target-related Diseases +
1 Human immunodeficiency virus disease [ICD-11: 1C60-1C62]
2 Inflammatory liver disease [ICD-11: DB97]
3 Postoperative inflammation [ICD-11: 1A00-CA43]
4 Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Function
The PD-1/PD-L1 axis is probably also important for immune evasion of B-cell lymphomas with a viral aetiology, including those associated with human immunodeficiency virus (HIV) and Epstein-Barr virus (EBV).
UniProt ID
PDCD1_HUMAN-PD1L1_HUMAN
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEETMQIPQAPWPV
VWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM
SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAP
KAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAV
ICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYAT
IVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
Drugs and Modes of Action
Patented Agent(s) [+] 73 Patented Agents +
1 1,2,4-oxadiazole derivative 4 Drug Info Patented Solid tumour/cancer [1]
2 1,2,4-oxadiazole derivative 5 Drug Info Patented Solid tumour/cancer [1]
3 1,2,4-oxadiazole derivative 6 Drug Info Patented Solid tumour/cancer [1]
4 1,2,4-oxadiazole derivative 7 Drug Info Patented Solid tumour/cancer [1]
5 1,3,4-oxadiazole derivative 3 Drug Info Patented Solid tumour/cancer [1]
6 1,3,4-oxadiazole derivative 4 Drug Info Patented Solid tumour/cancer [1]
7 1,3,4-oxadiazole derivative 5 Drug Info Patented Solid tumour/cancer [1]
8 1,3,4-oxadiazole derivative 6 Drug Info Patented Solid tumour/cancer [1]
9 1,3,4-thiadiazole derivative 1 Drug Info Patented Solid tumour/cancer [1]
10 1,3,4-thiadiazole derivative 2 Drug Info Patented Solid tumour/cancer [1]
11 1,3-dihydroxy phenyl derivative 1 Drug Info Patented Solid tumour/cancer [1]
12 1,3-dihydroxy phenyl derivative 2 Drug Info Patented Solid tumour/cancer [1]
13 3-substituted-1,2,4-oxadiazole derivative 1 Drug Info Patented Solid tumour/cancer [1]
14 3-substituted-1,2,4-oxadiazole derivative 2 Drug Info Patented Solid tumour/cancer [1]
15 Aromatic acetylene derivative 1 Drug Info Patented Solid tumour/cancer [1]
16 Aromatic ethylene derivative 1 Drug Info Patented Solid tumour/cancer [1]
17 Benzyl phenyl ether derivative 1 Drug Info Patented Solid tumour/cancer [1]
18 Benzyl phenyl ether derivative 2 Drug Info Patented Solid tumour/cancer [1]
19 Biaryl compound 1 Drug Info Patented Solid tumour/cancer [1]
20 Biaryl compound 2 Drug Info Patented Solid tumour/cancer [1]
21 Bromo benzyl ether derivative 1 Drug Info Patented Solid tumour/cancer [1]
22 Bromo benzyl ether derivative 2 Drug Info Patented Solid tumour/cancer [1]
23 Cyclic peptidomimetic derivative 1 Drug Info Patented Solid tumour/cancer [1]
24 Cyclic peptidomimetic derivative 2 Drug Info Patented Solid tumour/cancer [1]
25 Cyclic peptidomimetic derivative 3 Drug Info Patented Solid tumour/cancer [1]
26 Macrocycle derivative 1 Drug Info Patented Solid tumour/cancer [1]
27 Macrocycle derivative 2 Drug Info Patented Solid tumour/cancer [1]
28 Macrocycle derivative 3 Drug Info Patented Solid tumour/cancer [1]
29 Macrocycle derivative 4 Drug Info Patented Solid tumour/cancer [1]
30 Macrocycle derivative 5 Drug Info Patented Solid tumour/cancer [1]
31 Macrocycle derivative 6 Drug Info Patented Solid tumour/cancer [1]
32 Macrocycle derivative 7 Drug Info Patented Solid tumour/cancer [1]
33 Macrocycle derivative 8 Drug Info Patented Solid tumour/cancer [1]
34 Macrocycle derivative 9 Drug Info Patented Solid tumour/cancer [1]
35 Macrocyclic peptide analog 1 Drug Info Patented Solid tumour/cancer [1]
36 Macrocyclic peptide analog 2 Drug Info Patented Solid tumour/cancer [1]
37 Macrocyclic peptide analog 3 Drug Info Patented Solid tumour/cancer [1]
38 N-phenyl-pyridine-2-carboxamide derivative 1 Drug Info Patented Solid tumour/cancer [1]
39 N-phenyl-pyridine-2-carboxamide derivative 2 Drug Info Patented Solid tumour/cancer [1]
40 Peptide analog 1 Drug Info Patented Solid tumour/cancer [1]
41 Peptide analog 2 Drug Info Patented Solid tumour/cancer [1]
42 Peptide analog 3 Drug Info Patented Solid tumour/cancer [1]
43 Peptide analog 4 Drug Info Patented Solid tumour/cancer [1]
44 Peptide analog 5 Drug Info Patented Solid tumour/cancer [1]
45 Peptide analog 6 Drug Info Patented Solid tumour/cancer [1]
46 Phenylate derivative 1 Drug Info Patented Solid tumour/cancer [1]
47 Phenylate derivative 2 Drug Info Patented Solid tumour/cancer [1]
48 PMID30107136-Compound-Example11 Drug Info Patented Solid tumour/cancer [1]
49 PMID30107136-Compound-Example12 Drug Info Patented Solid tumour/cancer [1]
50 PMID30107136-Compound-Example13 Drug Info Patented Solid tumour/cancer [1]
51 PMID30107136-Compound-Example14 Drug Info Patented Solid tumour/cancer [1]
52 PMID30107136-Compound-Example3 Drug Info Patented Solid tumour/cancer [1]
53 PMID30107136-Compound-Example4 Drug Info Patented Solid tumour/cancer [1]
54 PMID30107136-Compound-Example41 Drug Info Patented Solid tumour/cancer [1]
55 PMID30107136-Compound-Example42 Drug Info Patented Solid tumour/cancer [1]
56 PMID30107136-Compound-Example43 Drug Info Patented Solid tumour/cancer [1]
57 PMID30107136-Compound-Example44 Drug Info Patented Solid tumour/cancer [1]
58 PMID30107136-Compound-Example45 Drug Info Patented Solid tumour/cancer [1]
59 PMID30107136-Compound-Example46 Drug Info Patented Solid tumour/cancer [1]
60 PMID30107136-Compound-Example47 Drug Info Patented Solid tumour/cancer [1]
61 PMID30107136-Compound-Example48 Drug Info Patented Solid tumour/cancer [1]
62 PMID30107136-Compound-Example49 Drug Info Patented Solid tumour/cancer [1]
63 PMID30107136-Compound-Example50 Drug Info Patented Solid tumour/cancer [1]
64 PMID30107136-Compound-Example51 Drug Info Patented Solid tumour/cancer [1]
65 PMID30107136-Compound-Example52 Drug Info Patented Solid tumour/cancer [1]
66 PMID30107136-Compound-Example53 Drug Info Patented Solid tumour/cancer [1]
67 PMID30107136-Compound-Example54 Drug Info Patented Solid tumour/cancer [1]
68 PMID30107136-Compound-Example57 Drug Info Patented Solid tumour/cancer [1]
69 PMID30107136-Compound-Example58 Drug Info Patented Solid tumour/cancer [1]
70 PMID30107136-Compound-Example59 Drug Info Patented Solid tumour/cancer [1]
71 PMID30107136-Compound-Example60 Drug Info Patented Solid tumour/cancer [1]
72 PMID30107136-Compound-Example7 Drug Info Patented Solid tumour/cancer [1]
73 PMID30107136-Compound-Example8 Drug Info Patented Solid tumour/cancer [1]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 97 Inhibitor drugs +
1 1,2,4-oxadiazole derivative 4 Drug Info [1]
2 1,2,4-oxadiazole derivative 5 Drug Info [1]
3 1,2,4-oxadiazole derivative 6 Drug Info [1]
4 1,2,4-oxadiazole derivative 7 Drug Info [1]
5 1,3,4-oxadiazole derivative 3 Drug Info [1]
6 1,3,4-oxadiazole derivative 4 Drug Info [1]
7 1,3,4-oxadiazole derivative 5 Drug Info [1]
8 1,3,4-oxadiazole derivative 6 Drug Info [1]
9 1,3,4-thiadiazole derivative 1 Drug Info [1]
10 1,3,4-thiadiazole derivative 2 Drug Info [1]
11 1,3-dihydroxy phenyl derivative 1 Drug Info [1]
12 1,3-dihydroxy phenyl derivative 2 Drug Info [1]
13 3-substituted-1,2,4-oxadiazole derivative 1 Drug Info [1]
14 3-substituted-1,2,4-oxadiazole derivative 2 Drug Info [1]
15 Aromatic acetylene derivative 1 Drug Info [1]
16 Aromatic ethylene derivative 1 Drug Info [1]
17 Benzyl phenyl ether derivative 1 Drug Info [1]
18 Benzyl phenyl ether derivative 2 Drug Info [1]
19 Biaryl compound 1 Drug Info [1]
20 Biaryl compound 2 Drug Info [1]
21 Bromo benzyl ether derivative 1 Drug Info [1]
22 Bromo benzyl ether derivative 2 Drug Info [1]
23 Cyclic peptidomimetic derivative 1 Drug Info [1]
24 Cyclic peptidomimetic derivative 2 Drug Info [1]
25 Cyclic peptidomimetic derivative 3 Drug Info [1]
26 Macrocycle derivative 1 Drug Info [1]
27 Macrocycle derivative 2 Drug Info [1]
28 Macrocycle derivative 3 Drug Info [1]
29 Macrocycle derivative 4 Drug Info [1]
30 Macrocycle derivative 5 Drug Info [1]
31 Macrocycle derivative 6 Drug Info [1]
32 Macrocycle derivative 7 Drug Info [1]
33 Macrocycle derivative 8 Drug Info [1]
34 Macrocycle derivative 9 Drug Info [1]
35 Macrocyclic peptide analog 1 Drug Info [1]
36 Macrocyclic peptide analog 2 Drug Info [1]
37 Macrocyclic peptide analog 3 Drug Info [1]
38 N-phenyl-pyridine-2-carboxamide derivative 1 Drug Info [1]
39 N-phenyl-pyridine-2-carboxamide derivative 2 Drug Info [1]
40 Peptide analog 1 Drug Info [1]
41 Peptide analog 2 Drug Info [1]
42 Peptide analog 3 Drug Info [1]
43 Peptide analog 4 Drug Info [1]
44 Peptide analog 5 Drug Info [1]
45 Peptide analog 6 Drug Info [1]
46 Phenylate derivative 1 Drug Info [1]
47 Phenylate derivative 2 Drug Info [1]
48 PMID30107136-Compound-Example11 Drug Info [1]
49 PMID30107136-Compound-Example12 Drug Info [1]
50 PMID30107136-Compound-Example13 Drug Info [1]
51 PMID30107136-Compound-Example14 Drug Info [1]
52 PMID30107136-Compound-Example3 Drug Info [1]
53 PMID30107136-Compound-Example4 Drug Info [1]
54 PMID30107136-Compound-Example41 Drug Info [1]
55 PMID30107136-Compound-Example42 Drug Info [1]
56 PMID30107136-Compound-Example43 Drug Info [1]
57 PMID30107136-Compound-Example44 Drug Info [1]
58 PMID30107136-Compound-Example45 Drug Info [1]
59 PMID30107136-Compound-Example46 Drug Info [1]
60 PMID30107136-Compound-Example47 Drug Info [1]
61 PMID30107136-Compound-Example48 Drug Info [1]
62 PMID30107136-Compound-Example49 Drug Info [1]
63 PMID30107136-Compound-Example50 Drug Info [1]
64 PMID30107136-Compound-Example51 Drug Info [1]
65 PMID30107136-Compound-Example52 Drug Info [1]
66 PMID30107136-Compound-Example53 Drug Info [1]
67 PMID30107136-Compound-Example54 Drug Info [1]
68 PMID30107136-Compound-Example57 Drug Info [1]
69 PMID30107136-Compound-Example58 Drug Info [1]
70 PMID30107136-Compound-Example59 Drug Info [1]
71 PMID30107136-Compound-Example60 Drug Info [1]
72 PMID30107136-Compound-Example7 Drug Info [1]
73 PMID30107136-Compound-Example8 Drug Info [1]
74 MAX-10129 Drug Info [2]
75 PMID30247903-Compound-General structure18 Drug Info [2]
76 PMID30247903-Compound-General structure19 Drug Info [2]
77 PMID30247903-Compound-General structure26 Drug Info [2]
78 PMID30247903-Compound-General structure27 Drug Info [2]
79 PMID30247903-Compound-General structure28 Drug Info [2]
80 PMID30247903-Compound-General structure29 Drug Info [2]
81 PMID30247903-Compound-General structure30 Drug Info [2]
82 PMID30247903-Compound-General structure31 Drug Info [2]
83 PMID30247903-Compound-General structure32 Drug Info [2]
84 PMID30247903-Compound-General structure33 Drug Info [2]
85 PMID30247903-Compound-General structure34 Drug Info [2]
86 PMID30247903-Compound-General structure35 Drug Info [2]
87 PMID30247903-Compound-General structure36 Drug Info [2]
88 PMID30247903-Compound-General structure37 Drug Info [2]
89 PMID30247903-Compound-General structure38 Drug Info [2]
90 PMID30247903-Compound-General structure39 Drug Info [2]
91 PMID30247903-Compound-General structure40 Drug Info [2]
92 PMID30247903-Compound-General structure41 Drug Info [2]
93 PMID30247903-Compound-General structure42 Drug Info [2]
94 PMID30247903-Compound-General structure43 Drug Info [2]
95 PMID30247903-Compound-General structure44 Drug Info [2]
96 PMID30247903-Compound-General structure45 Drug Info [2]
97 PMID30247903-Compound-General structure46 Drug Info [2]
References
REF 1 A patent review on PD-1/PD-L1 antagonists: small molecules, peptides, and macrocycles (2015-2018).Expert Opin Ther Pat. 2018 Sep;28(9):665-678.
REF 2 Development of Inhibitors of the Programmed Cell Death-1/Programmed Cell Death-Ligand 1 Signaling Pathway.J Med Chem. 2019 Feb 28;62(4):1715-1730.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.