Target General Infomation
Target ID
T15441
Target Name
Ubiquitin C-terminal hydrolase UCH37 (UCHL5)
Synonyms
Ubiquitin thioesterase L5; Ubiquitin carboxyl-terminal hydrolase isozyme L5; UCH37; UCH-L5; CGI-70; AD-019
Gene Name
UCHL5
Target Type
Patented-recorded target
[1]
Function
Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1. Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains.
BioChemical Class
Peptidase
UniProt ID
UCHL5_HUMAN
EC Number
EC 3.4.19.12
Sequence
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 1 Inhibitor drugs +
1 PMID26077642-Compound-Figure3A Drug Info [1]
Target Regulators
Target-interacting Proteins
References
REF 1 Deubiquitinases (DUBs) and DUB inhibitors: a patent review.Expert Opin Ther Pat. 2015;25(10):1191-1208.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.