Target General Infomation
Target ID
T23145 (Former ID: TTDS00419)
Target Name
Cholesterol desmolase (CYP11A1)
Synonyms
P450(scc); Cytochrome P450(scc); Cytochrome P450 11A1; Cholesterol side-chain cleavage enzyme, mitochondrial; CYPXIA1; CYP11A
Gene Name
CYP11A1
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Cushing syndrome [ICD-11: 5A70]
Function
Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone, the precursor of most steroid hormones.
BioChemical Class
Paired donor oxygen oxidoreductase
UniProt ID
CP11A_HUMAN
EC Number
EC 1.14.15.6
Sequence
MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWL
NLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPER
FLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVS
VLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQM
FHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG
ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAAR
HQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIY
ALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINML
ENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Aminoglutethimide Drug Info Approved Cushing disease [1], [2]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 3 Inhibitor drugs +
1 Aminoglutethimide Drug Info [1]
2 3-(4-Amino-phenyl)-3-butyl-piperidine-2,6-dione Drug Info [3]
3 3-(4-Amino-phenyl)-3-pentyl-piperidine-2,6-dione Drug Info [3]
Target Regulators
Target-regulating Transcription Factors
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
BioCyc [+] 2 BioCyc Pathways +
1 Superpathway of steroid hormone biosynthesis
2 Pregnenolone biosynthesis
KEGG Pathway [+] 3 KEGG Pathways +
1 Steroid hormone biosynthesis
2 Metabolic pathways
3 Ovarian steroidogenesis
NetPath Pathway [+] 1 NetPath Pathways +
1 FSH Signaling Pathway
Pathwhiz Pathway [+] 1 Pathwhiz Pathways +
1 Steroidogenesis
Reactome [+] 1 Reactome Pathways +
1 Endogenous sterols
WikiPathways [+] 7 WikiPathways +
1 Prostaglandin Synthesis and Regulation
2 Metapathway biotransformation
3 Oxidation by Cytochrome P450
4 Metabolism of steroid hormones and vitamin D
5 Glucocorticoid & Mineralcorticoid Metabolism
6 Corticotropin-releasing hormone
7 Phase 1 - Functionalization of compounds
References
REF 1 Breakdown of Th cell immune responses and steroidogenic CYP11A1 expression in CD4+ T cells in a murine model implanted with B16 melanoma. Cell Immunol. 2000 Nov 25;206(1):7-15.
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7054).
REF 3 Aromatase inhibitors. Synthesis and evaluation of mammary tumor inhibiting activity of 3-alkylated 3-(4-aminophenyl)piperidine-2,6-diones. J Med Chem. 1986 Aug;29(8):1362-9.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.