Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T30081
(Former ID: TTDR00500)
|
||||
Target Name |
Thymidine kinase 1 (TK1)
|
||||
Synonyms |
Thymidine kinase, cytosolic
|
||||
Gene Name |
TK1
|
||||
Target Type |
Successful target
|
[1] | |||
Disease | [+] 2 Target-related Diseases | + | |||
1 | Acute myeloid leukaemia [ICD-11: 2A60] | ||||
2 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | ||||
Function |
cytosol, identical protein binding, thymidine kinase activity, zinc ion binding, DNA metabolic process, nucleobase-containing compound metabolic process, protein homotetramerization, pyrimidine nucleoside salvage, thymidine metabolic process
|
||||
BioChemical Class |
Kinase
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.1.21
|
||||
Sequence |
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN |
||||
Drugs and Modes of Action | |||||
Approved Drug(s) | [+] 2 Approved Drugs | + | |||
1 | DEOXYCYTIDINE | Drug Info | Approved | Acute myeloid leukaemia | [2], [3] |
2 | Penciclovir | Drug Info | Approved | Human immunodeficiency virus infection | [2], [4] |
Clinical Trial Drug(s) | [+] 7 Clinical Trial Drugs | + | |||
1 | TK-DLI | Drug Info | Preregistration | Graft-versus-host disease | [5] |
2 | FV-100 | Drug Info | Phase 3 | Varicella zoster virus infection | [6] |
3 | Radiosensitizer gene therapy | Drug Info | Phase 3 | Pancreatic cancer | [7] |
4 | HQK-1004 | Drug Info | Phase 2 | Solid tumour/cancer | [8] |
5 | Ad-OC-hsvTK/valacyclovir | Drug Info | Phase 1 | Prostate cancer | [9] |
6 | Rilapladib | Drug Info | Phase 1 | Cardiovascular disease | [10] |
7 | Thymidine kinase-expressing adenovirus and ganciclovir suicide gene therapy | Drug Info | Phase 1 | Solid tumour/cancer | [11] |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | |||
1 | Sitimagene ceradenovec | Drug Info | Discontinued in Phase 3 | Brain cancer | [12] |
Mode of Action | [+] 2 Modes of Action | + | |||
Inhibitor | [+] 37 Inhibitor drugs | + | |||
1 | DEOXYCYTIDINE | Drug Info | [13] | ||
2 | Penciclovir | Drug Info | [1] | ||
3 | FV-100 | Drug Info | [15] | ||
4 | Radiosensitizer gene therapy | Drug Info | [16] | ||
5 | Rilapladib | Drug Info | [18] | ||
6 | Ad-OC-hsvTK/valacyclovir | Drug Info | [19] | ||
7 | (South)-Methanocarba-Thymidine | Drug Info | [1] | ||
8 | 1-[(Z)-4-(triphenylmethoxy)-2-butenyl]thymine | Drug Info | [22] | ||
9 | 1-[2-(2-triphenylmethoxyethoxy)ethyl]thymine | Drug Info | [22] | ||
10 | 1-[5-(triphenylmethoxy)pentyl]thymine | Drug Info | [22] | ||
11 | 1-[6-(triphenylmethoxy)hexyl]thymine | Drug Info | [22] | ||
12 | 1-[7-(triphenylmethoxy)heptyl]thymine | Drug Info | [22] | ||
13 | 2'-deoxythymidine triphosphate | Drug Info | [1] | ||
14 | 2'-Deoxyuridine | Drug Info | [13] | ||
15 | 2-phenylamino-9-(4-hydroxy-butyl)-6-oxopurine | Drug Info | [23] | ||
16 | 3'-(1,2,3-Triazol-1-yl)-3'-deoxy-beta-D-thymidine | Drug Info | [24] | ||
17 | 3-(2-propyn-1-yl)thymidine | Drug Info | [25] | ||
18 | 5-Bromothienyldeoxyuridine | Drug Info | [1] | ||
19 | 5-Bromovinyldeoxyuridine | Drug Info | [26] | ||
20 | 5-Iodo-2'-Deoxyuridine-5'-Monophosphate | Drug Info | [1] | ||
21 | 5-Iododeoxyuridine | Drug Info | [1] | ||
22 | 5-propyl-2'-deoxyuridine | Drug Info | [23] | ||
23 | 6-(Dihydroxy-Isobutyl)-Thymine | Drug Info | [1] | ||
24 | 6-Hydroxypropylthymine | Drug Info | [1] | ||
25 | 9-(4-Hydroxybutyl)-N2-Phenylguanine | Drug Info | [1] | ||
26 | 9-Hydroxypropyladenine, R-Isomer | Drug Info | [1] | ||
27 | 9-Hydroxypropyladenine, S-Isomer | Drug Info | [1] | ||
28 | Adenosine-5'-Diphosphate | Drug Info | [26] | ||
29 | BVDU-MP | Drug Info | [27] | ||
30 | Deoxythymidine | Drug Info | [1] | ||
31 | Edoxudine | Drug Info | [23] | ||
32 | ITdU | Drug Info | [18] | ||
33 | L-5-(bromovinyl)deoxyuridine | Drug Info | [23] | ||
34 | L-5-iodo-2'-deoxyuridine | Drug Info | [23] | ||
35 | N2-(3-trifluoromethylphenyl)guanine | Drug Info | [23] | ||
36 | P1-(5'-Adenosyl)P5-(5'-Thymidyl)Pentaphosphate | Drug Info | [26] | ||
37 | Thymidine-5'-Phosphate | Drug Info | [1] | ||
Modulator | [+] 4 Modulator drugs | + | |||
1 | TK-DLI | Drug Info | [14] | ||
2 | HQK-1004 | Drug Info | [17] | ||
3 | Thymidine kinase-expressing adenovirus and ganciclovir suicide gene therapy | Drug Info | [20] | ||
4 | Sitimagene ceradenovec | Drug Info | [21] | ||
Target Regulators | |||||
Target-regulating Transcription Factors | |||||
Target Profiles in Patients | |||||
Target Expression Profile (TEP) | |||||
Target-Related Models and Studies | |||||
Target Validation | |||||
Target QSAR Model | |||||
References | |||||
REF 1 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000912) | ||||
REF 4 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | ||||
REF 5 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023073) | ||||
REF 6 | ClinicalTrials.gov (NCT02412917) A Comparative Study of FV-100 vs. Valacyclovir for the Prevention of Post-Herpetic Neuralgia. U.S. National Institutes of Health. | ||||
REF 7 | Clinical pipeline report, company report or official report of Advantagene. | ||||
REF 8 | ClinicalTrials.gov (NCT00992732) Study of HQK-1004 and Valganciclovir to Treat Epstein-Barr Virus (EBV) - Positive Lymphoid Malignancies or Lymphoproliferative Disorders. U.S. National Institutes of Health. | ||||
REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007778) | ||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018454) | ||||
REF 11 | ClinicalTrials.gov (NCT00964756) A Study of an Infectivity Enhanced Suicide Gene Expressing Adenovirus for Ovarian Cancer in Patients With Recurrent Ovarian and Other Selected Gynecologic Cancers. U.S. National Institutes of Health. | ||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015264) | ||||
REF 13 | Species- or isozyme-specific enzyme inhibitors. 5. Differential effects of thymidine substituents on affinity for rat thymidine kinase isozymes. J Med Chem. 1982 Jun;25(6):644-9. | ||||
REF 14 | Company report (Takara Bio) | ||||
REF 15 | Specific recognition of the bicyclic pyrimidine nucleoside analogs, a new class of highly potent and selective inhibitors of varicella-zoster virus (VZV), by the VZV-encoded thymidine kinase. Mol Pharmacol. 2002 Feb;61(2):249-54. | ||||
REF 16 | Pronounced antitumor effects and tumor radiosensitization of double suicide gene therapy. Clin Cancer Res. 1997 Nov;3(11):2081-8. | ||||
REF 17 | Induction of the Epstein-Barr virus thymidine kinase gene with concomitant nucleoside antivirals as a therapeutic strategy for Epstein-Barr virus-associated malignancies. Curr Opin Oncol. 2001 Sep;13(5):360-7. | ||||
REF 18 | Trichomonas vaginalis thymidine kinase: purification, characterization and search for inhibitors. Biochem J. 1998 Aug 15;334 ( Pt 1):15-22. | ||||
REF 19 | Phase I dose escalation clinical trial of adenovirus vector carrying osteocalcin promoter-driven herpes simplex virus thymidine kinase in localized and metastatic hormone-refractory prostate cancer. Hum Gene Ther. 2003 Feb 10;14(3):227-41. | ||||
REF 20 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | ||||
REF 21 | Sitimagene ceradenovec: a gene-based drug for the treatment of operable high-grade glioma. Future Oncol. 2010 Nov;6(11):1691-710. | ||||
REF 22 | N1-substituted thymine derivatives as mitochondrial thymidine kinase (TK-2) inhibitors. J Med Chem. 2006 Dec 28;49(26):7766-73. | ||||
REF 23 | Sensitivity of monkey B virus (Cercopithecine herpesvirus 1) to antiviral drugs: role of thymidine kinase in antiviral activities of substrate anal... Antimicrob Agents Chemother. 2007 Jun;51(6):2028-34. | ||||
REF 24 | 3'-[4-Aryl-(1,2,3-triazol-1-yl)]-3'-deoxythymidine analogues as potent and selective inhibitors of human mitochondrial thymidine kinase. J Med Chem. 2010 Apr 8;53(7):2902-12. | ||||
REF 25 | Synthesis, in vitro, and in silico evaluation of organometallic technetium and rhenium thymidine complexes with retained substrate activity toward ... J Med Chem. 2008 Nov 13;51(21):6689-98. | ||||
REF 26 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41. | ||||
REF 27 | Crystal structure of varicella zoster virus thymidine kinase. J Biol Chem. 2003 Jul 4;278(27):24680-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.