Target General Infomation
Target ID
T30082 (Former ID: TTDS00140)
Target Name
Acetylcholinesterase (AChE)
Synonyms
YT; N-ACHE; ARACHE
Gene Name
ACHE
Target Type
Successful target
[1]
Disease [+] 6 Target-related Diseases +
1 Alzheimer disease [ICD-11: 8A20]
2 Glaucoma [ICD-11: 9C61]
3 Myasthenia gravis [ICD-11: 8C6Y]
4 Oesophageal/gastroduodenal disorder [ICD-11: DD90]
5 Pediculosis [ICD-11: 1G00]
6 Unspecific substance harmful effect [ICD-11: NE6Z]
Function
Role in neuronal apoptosis. Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft.
BioChemical Class
Carboxylic ester hydrolase
UniProt ID
ACES_HUMAN
EC Number
EC 3.1.1.7
Sequence
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Drugs and Modes of Action
Approved Drug(s) [+] 15 Approved Drugs +
1 Ambenonium Drug Info Approved Myasthenia gravis [2]
2 Demecarium bromide Drug Info Approved Open-angle glaucoma [3], [4]
3 Donepezil Drug Info Approved Alzheimer disease [4], [5], [6]
4 Echothiophate Iodide Drug Info Approved Chronic glaucoma [7]
5 Edrophonium Drug Info Approved Myasthenia gravis [8]
6 Galantamine Drug Info Approved Alzheimer disease [9], [10]
7 Huperzine A Drug Info Approved Alzheimer disease [4], [11]
8 Isoflurophate Drug Info Approved Glaucoma/ocular hypertension [12]
9 Malathion Drug Info Approved Pediculus capitis infestation [13]
10 Neostigmine Drug Info Approved Myasthenia gravis [14]
11 Pralidoxime Chloride Drug Info Approved Poisoning due to pesticides and chemicals [4]
12 Pyridostigmine Drug Info Approved Myasthenia gravis [15]
13 Rivastigmine Drug Info Approved Alzheimer disease [16], [17]
14 Tacrine Drug Info Approved Alzheimer disease [18], [19]
15 YM443 Drug Info Approved Functional dyspepsia [4]
Clinical Trial Drug(s) [+] 16 Clinical Trial Drugs +
1 (-)-Phenserine Drug Info Phase 3 Alzheimer disease [20]
2 Amocarzine Drug Info Phase 3 Helminth infection [21]
3 Eptastigmine Drug Info Phase 3 Cognitive impairment [22]
4 INM-176 Drug Info Phase 3 Alzheimer disease [23]
5 Suronacrine maleate Drug Info Phase 3 Cognitive impairment [24]
6 Ladostigil Drug Info Phase 2 Alzheimer disease [25]
7 Methanesulfonyl fluoride Drug Info Phase 2 Alzheimer disease [26]
8 R-phenserine Drug Info Phase 2 Cognitive impairment [27]
9 T-82 Drug Info Phase 2 Cognitive impairment [28]
10 CPC-212 Drug Info Phase 1 Alzheimer disease [29], [30]
11 CPC-250 Drug Info Phase 1 Alzheimer disease [29], [30]
12 Desoxypeganine Drug Info Phase 1 Alcohol dependence [31]
13 GTP-004 Drug Info Phase 1 Myasthenia gravis [29]
14 KW-5092 Drug Info Phase 1 Pain [32]
15 PRX-105 Drug Info Phase 1 Poison intoxication [33]
16 ZT-1 Drug Info Phase 1 Parkinson disease [34]
Discontinued Drug(s) [+] 19 Discontinued Drugs +
1 VELNACRINE Drug Info Discontinued in Phase 3 Cognitive impairment [35]
2 Zanapezil Drug Info Discontinued in Phase 3 Alzheimer disease [36]
3 Caracemide Drug Info Discontinued in Phase 2 Solid tumour/cancer [37]
4 HP-290 Drug Info Discontinued in Phase 2 Parkinson disease [38]
5 Icopezil maleate Drug Info Discontinued in Phase 2 Cognitive impairment [39]
6 Physostigmine Drug Info Discontinued in Phase 2 Xerostomia [40], [41]
7 S-9977 Drug Info Discontinued in Phase 2 Cognitive impairment [42]
8 SM-10888 Drug Info Discontinued in Phase 2 Cognitive impairment [43]
9 TAK-802 Drug Info Discontinued in Phase 2 Urinary dysfunction [44]
10 ZIFROSILONE Drug Info Discontinued in Phase 2 Cognitive impairment [45]
11 NP-61 Drug Info Discontinued in Phase 1 Alzheimer disease [46]
12 ABS-301 Drug Info Terminated Alzheimer disease [49]
13 CI-1002 Drug Info Terminated Alzheimer disease [50]
14 F-3796 Drug Info Terminated Alzheimer disease [51]
15 FR-152558 Drug Info Terminated Alzheimer disease [52]
16 MF-8615 Drug Info Terminated Alzheimer disease [53]
17 MF268 Drug Info Terminated Alzheimer disease [54]
18 NP-7557 Drug Info Terminated Alzheimer disease [55]
19 Ro-46-5934 Drug Info Terminated Alzheimer disease [56]
Preclinical Drug(s) [+] 2 Preclinical Drugs +
1 PHENSERINE TARTRATE Drug Info Preclinical Parkinson disease [47]
2 SPH-1285 Drug Info Preclinical Alzheimer disease [48]
Mode of Action [+] 4 Modes of Action +
Inhibitor [+] 306 Inhibitor drugs +
1 Ambenonium Drug Info [57]
2 Demecarium bromide Drug Info [58], [59]
3 Edrophonium Drug Info [61], [62], [63]
4 Galantamine Drug Info [64], [65], [66]
5 Huperzine A Drug Info [67]
6 Isoflurophate Drug Info [68]
7 Malathion Drug Info [69]
8 Neostigmine Drug Info [61], [62]
9 Pyridostigmine Drug Info [62]
10 Tacrine Drug Info [70]
11 (-)-Phenserine Drug Info [71]
12 Amocarzine Drug Info [72]
13 Eptastigmine Drug Info [22], [73]
14 INM-176 Drug Info [74]
15 Ladostigil Drug Info [25]
16 Methanesulfonyl fluoride Drug Info [76]
17 R-phenserine Drug Info [77]
18 T-82 Drug Info [28], [4]
19 CPC-212 Drug Info [29], [30]
20 CPC-250 Drug Info [29], [30]
21 GTP-004 Drug Info [29]
22 KW-5092 Drug Info [32]
23 PRX-105 Drug Info [78]
24 ZT-1 Drug Info [79], [4]
25 Decyle nelycorine dibromo salt derivative 1 Drug Info [81]
26 Di-substituted piperidine derivative 2 Drug Info [81]
27 Egonol compound 1 Drug Info [80]
28 Fluorinated donepezil derivative 1 Drug Info [80]
29 Fluorinated donepezil derivative 2 Drug Info [80]
30 Galantamine analog 1 Drug Info [80]
31 Indoline derivative 1 Drug Info [81]
32 Isochroman-4-ketone derivative 1 Drug Info [81]
33 Lycorine dimer salt derivative 1 Drug Info [80]
34 PMID27967267-Compound-12 Drug Info [80]
35 PMID27967267-Compound-13 Drug Info [80]
36 PMID27967267-Compound-14 Drug Info [80]
37 PMID27967267-Compound-15 Drug Info [80]
38 PMID27967267-Compound-3 Drug Info [80]
39 PMID27967267-Compound-39 Drug Info [80]
40 PMID27967267-Compound-42 Drug Info [80]
41 PMID27967267-Compound-43 Drug Info [80]
42 PMID27967267-Compound-7 Drug Info [80]
43 PMID27967267-Compound-neostenine Drug Info [80]
44 PMID27967267-Compound-neotuberostemonine Drug Info [80]
45 PMID27967267-Compound-stenine Drug Info [80]
46 PMID29757691-Compound-10 Drug Info [81]
47 PMID29757691-Compound-2a Drug Info [81]
48 PMID29757691-Compound-2a-i Drug Info [81]
49 PMID29757691-Compound-4 Drug Info [81]
50 PMID29757691-Compound-7 Drug Info [81]
51 PMID29757691-Compound-8a Drug Info [81]
52 PMID29757691-Compound-8b Drug Info [81]
53 PMID29757691-Compound-8c Drug Info [81]
54 PMID29757691-Compound-8d Drug Info [81]
55 Quinazoline alkaloid derivative 1 Drug Info [81]
56 Tacrine heterodimer derivative 1 Drug Info [81]
57 Tacrine-caffeic acid hybrid derivative 1 Drug Info [80]
58 Tacrine-caffeic acid hybrid derivative 2 Drug Info [80]
59 Tacrine-indole hybrid derivative 1 Drug Info [80]
60 Tacrine-indole hybrid derivative 2 Drug Info [80]
61 Tacrine-indole hybrid derivative 3 Drug Info [80]
62 Tacrine-phenothiazine hybrid derivative 1 Drug Info [80]
63 Tetra-hydro-isoquinoline derivative 1 Drug Info [81]
64 Tetra-hydro-isoquinoline derivative 2 Drug Info [81]
65 Tetra-hydro-isoquinoline derivative 3 Drug Info [81]
66 Tetra-hydro-isoquinoline derivative 4 Drug Info [81]
67 VELNACRINE Drug Info [82]
68 Zanapezil Drug Info [83]
69 Caracemide Drug Info [84]
70 HP-290 Drug Info [85], [73]
71 Icopezil maleate Drug Info [86]
72 Physostigmine Drug Info [87]
73 S-9977 Drug Info [88]
74 SM-10888 Drug Info [89]
75 TAK-802 Drug Info [90]
76 ZIFROSILONE Drug Info [91], [4]
77 NP-61 Drug Info [92]
78 PHENSERINE TARTRATE Drug Info [77], [4]
79 SPH-1285 Drug Info [93]
80 7-methoxytacrine Drug Info [94]
81 F-3796 Drug Info [96]
82 FR-152558 Drug Info [97]
83 MF-8615 Drug Info [98]
84 MF268 Drug Info [99]
85 NP-7557 Drug Info [100]
86 Ro-46-5934 Drug Info [56]
87 (+/-)-huprineY hydrochloride Drug Info [101]
88 (-)-huperzine B Drug Info [102]
89 (-)-Tolserine Drug Info [71]
90 (1R)-1,2,2-TRIMETHYLPROPYL (S)-METHYLPHOSPHINATE Drug Info [99]
91 (2-Butyryloxy-ethyl)-trimethyl-ammonium iodide Drug Info [103]
92 (2-Chloro-ethyl)-trimethyl-ammonium chloride Drug Info [103]
93 (2-Ethoxy-ethyl)-trimethyl-ammonium iodide Drug Info [103]
94 (2-Mercapto-ethyl)-trimethyl-ammonium iodide Drug Info [103]
95 (24S)-ethylcholesta-7,9(11),22(E)-triene-3b-ol Drug Info [104]
96 (3-Bromo-propyl)-trimethyl-ammonium Drug Info [103]
97 (3-Hydroxy-2-methyl-phenyl)-trimethyl-ammonium Drug Info [103]
98 (3R)-9-amino-3-methyl-1,2,3,4-tetrahydroacridine Drug Info [105]
99 (4-Bromo-butyl)-trimethyl-ammonium Drug Info [103]
100 (4-Iodo-butyl)-trimethyl-ammonium iodide Drug Info [103]
101 (5-Bromo-pentyl)-trimethyl-ammonium Drug Info [103]
102 (R)-tacrine(10)-hupyridone Drug Info [99]
103 (RS)-tacrine(10)-hupyridone Drug Info [102]
104 (S)-tacrine(10)-hupyridone Drug Info [99]
105 (S,S)-(-)-bis(10)-hupyridone Drug Info [102]
106 (S,S)-(-)-bis(12)-hupyridone Drug Info [102]
107 1,10-bis(pyridinium)-decane dibromide Drug Info [106]
108 1,11-bis(pyridinium)-undecane dibromide Drug Info [106]
109 1,2-Di(berberine-9-O-yl)ethane dibromide Drug Info [107]
110 1,2-NAPHTHOQUINONE Drug Info [108]
111 1,3-Bis-(3-imidazolidin-2-yl-phenyl)-urea Drug Info [109]
112 1,3-Di(berberine-9-O-yl)ethane dibromide Drug Info [107]
113 1,4-Di(berberine-9-O-yl)ethane dibromide Drug Info [107]
114 1,9-bis(pyridinium)-nonane dibromide Drug Info [106]
115 1-(3-Bromomethyl-phenyl)-2,2,2-trifluoro-ethanone Drug Info [110]
116 1-benzene sulfonyl-cis-2,6-dimethyl piperidine Drug Info [111]
117 1-Deoxy-1-Thio-Heptaethylene Glycol Drug Info [99]
118 1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE Drug Info [99]
119 10-Hydroxy-infractopicrin Drug Info [112]
120 2,3-dihydropyrrolo[2,1-b]quinazolin-9(1H)-imine Drug Info [113]
121 2-(Acetylamino)-2-Deoxy-a-D-Glucopyranose Drug Info [114]
122 2-(N-Morpholino)-Ethanesulfonic Acid Drug Info [114]
123 2-Hex-5-enyl-5-non-8-enyl-3,4-dihydro-2H-pyrrole Drug Info [115]
124 2-Hex-5-enyl-5-non-8-enyl-pyrrolidine Drug Info [115]
125 2-Hex-5-enyl-5-nonyl-pyrrolidine Drug Info [115]
126 2-morpholino-N-phenethylpyrimidin-4-amine Drug Info [116]
127 2-Propyl-beta-carboline-2-ium iodide Drug Info [117]
128 24-ethyl-cholest-7-ene-3,5,6-triol Drug Info [104]
129 24-ethylcholest-6-ene-3,5-diol Drug Info [104]
130 3,4,5,6-Tetrachloro-[1,2]benzoquinone Drug Info [118]
131 3,6,9,12,15-Pentaoxaheptadecane Drug Info [99]
132 3,7-BIS(DIMETHYLAMINO)PHENOTHIAZIN-5-IUM Drug Info [99]
133 3-(2,5-Dioxo-pyrrolidin-1-yl)-benzoic acid Drug Info [119]
134 3-(2-Diethylamino-acetamino)-rutaecarpine Drug Info [120]
135 3-(2-Diethylamino-propionamino)-rutaecarpine Drug Info [120]
136 3-(2-N-Piperidyl-acetamino)-rutaecarpine Drug Info [120]
137 3-(2-N-Piperidyl-propionamino)-rutaecarpine Drug Info [120]
138 3-(2-N-Pyrrolyl-acetamino)-rutaecarpine Drug Info [120]
139 3-(2-N-Pyrrolyl-propionamino)-rutaecarpine Drug Info [120]
140 3-(3-Carboxy-propionylamino)-benzoic acid Drug Info [119]
141 3-(4-Benzoylpiperazine-1-carbonyl)coumarin Drug Info [121]
142 3-(4-o-Tolylpiperazine-1-carbonyl)coumarin Drug Info [121]
143 3-(4-Phenylpiperazin-1-carbonyl)coumarin Drug Info [121]
144 3-(dimethylamino)phenyl phenylcarbamate Drug Info [71]
145 3-hydroxy-N,N,N-trimethylbenzenaminium iodide Drug Info [122]
146 3-[(1s)-1-(Dimethylamino)Ethyl]Phenol Drug Info [99]
147 3-[2-(1-Benzyl-piperidin-4-yl)-ethyl]-1H-indazole Drug Info [86]
148 3-[3-(benzylmethylamino)propoxy]xanthen-9-one Drug Info [123]
149 3-[4-(benzylmethylamino)butoxy]xanthen-9-one Drug Info [123]
150 3-[5-(benzylmethylamino)pentyloxy]xanthen-9-one Drug Info [123]
151 3-[6-(benzylmethylamino)hexyloxy]xanthen-9-one Drug Info [123]
152 3-[7-(benzylmethylamino)-heptyloxy]xanthen-9-one Drug Info [123]
153 3-[8-(benzylmethylamino)octyloxy]xanthen-9-one Drug Info [123]
154 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [124]
155 4-formylphenyl-O-beta-D-ribopyranoside Drug Info [125]
156 4-formylphenyl-O-beta-Dglucopyranoside Drug Info [125]
157 4-ISOPROPYLPHENSERINE Drug Info [126]
158 4-[4-(benzhydryloxy)piperidino]butyl benzoate Drug Info [127]
159 4ALPHA-(HYDROXYMETHYL)-4ALPHA-DEMETHYLTERRITREM B Drug Info [128]
160 5,6-dinitroacenaphthoquinone Drug Info [108]
161 5-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [129]
162 5-Hex-5-enyl-2-nonyl-3,4-dihydro-2H-pyrrole Drug Info [115]
163 6,8-Dichloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [130]
164 6-chlorotacrine hydrochloride Drug Info [131]
165 6-hydroxy-1,2,9-trimethyl-9H-beta-carbolin-2-ium Drug Info [132]
166 6-hydroxy-1,2-dimethyl-9H-beta-carbolin-2-ium Drug Info [132]
167 6-hydroxy-2,9-dimethyl-9H-beta-carbolin-2-ium Drug Info [132]
168 6-hydroxy-2-methyl-9H-beta-carbolin-2-ium Drug Info [132]
169 6-methoxy-1,2-dimethyl-9H-beta-carbolin-2-ium Drug Info [132]
170 6-methoxy-1,9-dimethyl-9H-pyrido[3,4-b]indole Drug Info [132]
171 6-methoxy-2,9-dimethyl-9H-beta-carbolin-2-ium Drug Info [132]
172 6-methoxy-2-methyl-9H-beta-carbolin-2-ium Drug Info [132]
173 6-Methyl-4-(4-benzoylpiperazin-1-yl)coumarin Drug Info [121]
174 6-Methyl-4-(4-o-tolylpiperazin-1-yl)coumarin Drug Info [121]
175 6-Methyl-4-(4-phenylpiperazin-1-yl)coumarin Drug Info [121]
176 7-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [129]
177 7-Oxo-7H-dibenzo[de,g]quinoline Drug Info [133]
178 8-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine Drug Info [129]
179 9-Amino-1,2,3,4-tetrahydro-acridine-1,7-diol Drug Info [82]
180 9-amino-7H-dibenzo[de,h]quinolin-7-one Drug Info [133]
181 9-Ethyl-2-methyl-beta-carboline-2-ium iodide Drug Info [117]
182 9-Ethyl-beta-carboline Drug Info [117]
183 9-hydrazino-1,2,3,4-tetrahydroacridine Drug Info [134]
184 9-O-[2-(Phenylol-1-yloxy)ethyl]berberine bromide Drug Info [135]
185 9-O-[2-(Phenylol-1-yloxy)hexyl]berberine bromide Drug Info [135]
186 9-O-[3-(2-Pyridinoxyl)butyl]-berberine bromide Drug Info [107]
187 9-O-[3-(4-Bromo-phenoxyl)butyl]-berberine bromide Drug Info [107]
188 9-O-[3-(4-Nitro-phenoxyl)butyl]-berberine bromide Drug Info [107]
189 9-O-[3-(Phenylamino)propyl]-berberine bromide Drug Info [107]
190 9-O-[3-(Phenylol-1-yloxy)propyl]berberine bromide Drug Info [135]
191 9-O-[4-(Phenylol-1-yloxy)butyl]berberine bromide Drug Info [135]
192 9-O-[5-(Phenylol-1-yloxy)pentyl]berberine bromide Drug Info [135]
193 Alkylene Linked Bis-Galanthamine derivative Drug Info [136]
194 Allyl-trimethyl-ammonium Drug Info [103]
195 AP-2238 Drug Info [137]
196 AP-2243 Drug Info [138]
197 BENZOQUINONE Drug Info [118]
198 Beta-L-fucose Drug Info [139]
199 BIS(12)-HUPERZINE B Drug Info [140]
200 Bis(14)-Huperzine B Drug Info [140]
201 BIS(16)-HUPERZINE B Drug Info [140]
202 BIS(18)-HUPERZINE B Drug Info [140]
203 BIS(20)-HUPERZINE B Drug Info [140]
204 BIS(8)-HUPERZINE B Drug Info [140]
205 BIS(9)-HUPERZINE B Drug Info [140]
206 Bis-7-tacrine Drug Info [116]
207 But-3-enyl-trimethyl-ammonium bromide Drug Info [103]
208 BW284C51 Drug Info [141], [142]
209 BZYX Drug Info [1]
210 CAPROCTAMINE Drug Info [143]
211 Carinatumins B (2) Drug Info [144]
212 CHF-2819 Drug Info [145]
213 CHLORANIL Drug Info [118]
214 Chlorphrifos oxon Drug Info [146]
215 CHLORPYRIFOS Drug Info [147]
216 CHOLINE IODIDE Drug Info [103]
217 Cis-2,6-dimethyl-1-methyl sulfonyl piperidine Drug Info [111]
218 CLEBOPRIDE Drug Info [109]
219 CORONARIDINE Drug Info [148]
220 CRYPTADINE B Drug Info [150]
221 DECIDIUM Drug Info [102]
222 Dimethyl-pent-4-enyl-ammonium bromide Drug Info [103]
223 Ethyl octylfluorophosphonate Drug Info [146]
224 ETHYLPHENSERINE Drug Info [73]
225 Fucose Drug Info [114]
226 Galanthamine derivative Drug Info [102]
227 GANSTIGMINE Drug Info [102]
228 GENESERINE Drug Info [145]
229 HALOXYSTEROL A Drug Info [104]
230 HALOXYSTEROL B Drug Info [104]
231 Haloxysterol C Drug Info [104]
232 Haloxysterol D Drug Info [104]
233 Hexyl-trimethyl-ammonium Drug Info [103]
234 Huperaine A Drug Info [99]
235 Huprine X Drug Info [102]
236 Huprine Y Drug Info [151]
237 Huprine-Tacrine Heterodimer Drug Info [152]
238 INFRACTOPICRIN Drug Info [112]
239 Iso-OMPA Drug Info [142]
240 Isopropyl dodecylfluorophosphonate Drug Info [146]
241 Isosorbide-2-(methylcarbamate)-5-benzoate Drug Info [142]
242 Isosorbide-2-(methylcarbamate)-5-mononitrate Drug Info [142]
243 Isosorbide-2-benzylcarbamate-5-cyclopentanoate Drug Info [142]
244 Isosorbide-2-benzylcarbamate-5-cyclopropanoate Drug Info [142]
245 Isosorbide-2-benzylcarbamate-5-tosylate Drug Info [142]
246 Isosorbide-di-(4-nitrophenyl carbamate) Drug Info [153]
247 Isosorbide-di-(benzylcarbamate) Drug Info [153]
248 Isosorbide-di-(ethylcarbamate) Drug Info [153]
249 Isosorbide-di-phenylcarbamate Drug Info [153]
250 LAWSARITOL Drug Info [104]
251 LIPOCRINE Drug Info [154]
252 LYSICAMINE Drug Info [155]
253 MEMOQUIN Drug Info [154]
254 MESUAGENIN A Drug Info [156]
255 MESUAGENIN B Drug Info [156]
256 Mesuagenin D Drug Info [156]
257 Methyl Phosphinic Acid Drug Info [114]
258 Monoisopropylphosphorylserine Drug Info [114]
259 N,N'-(1',10'-decylene)-bis-(-)-nor-MEP Drug Info [157]
260 N,N'-(1',11'-undecydene)-bis-(-)-nor-MEP Drug Info [157]
261 N,N'-(1',12'-dodecydene)-bis-(-)-nor-MEP Drug Info [157]
262 N,N'-(1',5'-pentylene)-bis-(-)-nor-MEP Drug Info [157]
263 N,N'-(1',6-hexylene)-bis-(-)-nor-MEP Drug Info [157]
264 N,N'-(1',7'-heptylene)-bis-(-)-nor-MEP Drug Info [157]
265 N,N'-(1',8'-octylene)-bis-(-)-nor-MEP Drug Info [157]
266 N,N'-(1',9'-nonylene)-bis-(-)-nor-MEP Drug Info [157]
267 N-(14-methylallyl)norgalanthamine Drug Info [158]
268 N-ALLYLNORGALANTHAMINE Drug Info [158]
269 N-allylnorlitebamine Drug Info [159]
270 N-benzyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine Drug Info [116]
271 N-benzyl-2-morpholinopyrimidin-4-amine Drug Info [116]
272 N-benzyl-2-thiomorpholinopyrimidin-4-amine Drug Info [116]
273 N-benzylnorlitebamine Drug Info [159]
274 N-butylnorlitebamine Drug Info [159]
275 N-isobutylnorlitebamine Drug Info [159]
276 N-isopropylnorlitebamine Drug Info [159]
277 N-isopropylnorlitebamineN-methoiodide Drug Info [159]
278 N-Methyl-1'H-phenothiazine-1'-carboxamide Drug Info [160]
279 N-n-dodecyl-7-methoxytacrine hydrochloride Drug Info [94]
280 N-n-heptyl-7-methoxytacrine hydrochloride Drug Info [94]
281 N-n-hexyl-7-methoxytacrine hydrochloride Drug Info [94]
282 N-n-nonyl-7-methoxytacrine hydrochloride Drug Info [94]
283 N-n-octyl-7-methoxytacrine hydrochloride Drug Info [94]
284 N-n-pentyl-7-methoxytacrine hydrochloride Drug Info [94]
285 N-n-propyl-7-methoxytacrine hydrochloride Drug Info [94]
286 N-phenethyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine Drug Info [116]
287 N-propylnorlitebamine Drug Info [159]
288 NSC-23180 Drug Info [108]
289 OBIDOXIME Drug Info [147]
290 PARAOXON Drug Info [146]
291 Petrosamine Drug Info [161]
292 Propidium Drug Info [114]
293 Pseudocolumbamine trifluoroacetate Drug Info [155]
294 Pseudopalmatine trifluoroacetate Drug Info [155]
295 TACRINE(8)-4-AMINOQUINOLINE Drug Info [99]
296 TASPINE Drug Info [162]
297 TERRITREM B Drug Info [163]
298 Tetraethylene Glycol Drug Info [114]
299 THIOCTIC ACID Drug Info [164]
300 TOLSERINE Drug Info [73]
301 TRIMEDOXIME Drug Info [147]
302 Trimethyl-(3-nitro-phenyl)-ammonium iodide Drug Info [103]
303 Trimethyl-(4-oxo-pentyl)-ammonium iodide Drug Info [103]
304 TURBINATINE Drug Info [165]
305 VOACANGINE Drug Info [148]
306 XANTHOSTIGMINE Drug Info [166]
Modulator [+] 11 Modulator drugs +
1 Donepezil Drug Info [1]
2 Echothiophate Iodide Drug Info [60]
3 Pralidoxime Chloride Drug Info [60]
4 Rivastigmine Drug Info [1]
5 YM443 Drug Info [4]
6 Suronacrine maleate Drug Info [75]
7 Desoxypeganine Drug Info [31]
8 ABS-301 Drug Info [95]
9 CI-1002 Drug Info [50]
10 CP-126998 Drug Info [149]
11 NPRx-30 Drug Info [1]
Reactivator [+] 8 Reactivator drugs +
1 2-PAM derivative 1 Drug Info [80]
2 4-PAM derivative 1 Drug Info [80]
3 Amidine oxime derivative 1 Drug Info [80]
4 PMID27967267-Compound-47 Drug Info [80]
5 PMID27967267-Compound-48 Drug Info [80]
6 PMID27967267-Compound-49 Drug Info [80]
7 PMID27967267-Compound-51 Drug Info [80]
8 PMID27967267-Compound-52 Drug Info [80]
Activator [+] 1 Activator drugs +
1 MMB-4 Drug Info [1]
Target Regulators
Target-regulating microRNAs
Target-regulating Transcription Factors
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 2 KEGG Pathways +
1 Glycerophospholipid metabolism
2 Cholinergic synapse
Panther Pathway [+] 3 Panther Pathways +
1 Muscarinic acetylcholine receptor 1 and 3 signaling pathway
2 Muscarinic acetylcholine receptor 2 and 4 signaling pathway
3 Nicotinic acetylcholine receptor signaling pathway
Pathwhiz Pathway [+] 1 Pathwhiz Pathways +
1 Phospholipid Biosynthesis
PID Pathway [+] 1 PID Pathways +
1 ATF-2 transcription factor network
WikiPathways [+] 4 WikiPathways +
1 Monoamine Transport
2 Biogenic Amine Synthesis
3 Acetylcholine Synthesis
4 Integrated Pancreatic Cancer Pathway
Target-Related Models and Studies
Target Validation
Target QSAR Model
References
REF 1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2465).
REF 2 FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010155.
REF 3 FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011860.
REF 4 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
REF 5 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6599).
REF 6 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001402)
REF 7 FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011963.
REF 8 FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040131.
REF 9 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6693).
REF 10 Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
REF 11 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000687)
REF 12 Anaesthetic drugs: linking molecular actions to clinical effects. Curr Pharm Des. 2006;12(28):3665-79.
REF 13 FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 078743.
REF 14 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
REF 15 FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040457.
REF 16 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6602).
REF 17 ClinicalTrials.gov (NCT00948766) Effects of Rivastigmine Patch on Activities of Daily Living and Cognition in Patients With Severe Dementia of the Alzheimer's Type (ACTION) (Study Protocol CENA713DUS44, NCT00948766) and a 24 Week Open-label Extension to Study CENA713DUS44. U.S. National Institutes of Health.
REF 18 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6687).
REF 19 Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
REF 20 Neurotrophic and neuroprotective actions of (-)- and (+)-phenserine, candidate drugs for Alzheimer's disease. PLoS One. 2013;8(1):e54887.
REF 21 The safety and efficacy of amocarzine in African onchocerciasis and the influence of ivermectin on the clinical and parasitological response to treatment. Ann Trop Med Parasitol. 1997 Apr;91(3):281-96.
REF 22 Eptastigmine: ten years of pharmacology, toxicology, pharmacokinetic, and clinical studies. CNS Drug Rev. 2001 Winter;7(4):369-86.
REF 23 ClinicalTrials.gov (NCT01245530) An Efficacy and Safety Study of INM-176 for the Treatment of Patients With Alzheimer Type Dementia. U.S. National Institutes of Health.
REF 24 Handbook of Dementing Illnesses, Morris John. Page(570).
REF 25 Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
REF 26 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033430)
REF 27 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021506)
REF 28 Effects of T-82, a novel acetylcholinesterase inhibitor, on impaired learning and memory in passive avoidance task in rats. Eur J Pharmacol. 2003 Mar 28;465(1-2):97-103.
REF 29 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 30 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 31 Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7.
REF 32 Oral administration of KW-5092, a novel gastroprokinetic agent with acetylcholinesterase inhibitory and acetylcholine release enhancing activities, causes a dose-dependent increase in the blood acetylcholine content of beagle dogs. Neurosci Lett. 1997 Mar 28;225(1):25-8.
REF 33 ClinicalTrials.gov (NCT01093859) An Exploratory Phase 1 Microdose Study of PRX-105. U.S. National Institutes of Health.
REF 34 Phase I study on the pharmacokinetics and tolerance of ZT-1, a prodrug of huperzine A, for the treatment of Alzheimer's disease. Acta Pharmacol Sin. 2013 Jul;34(7):976-82.
REF 35 Velnacrine for Alzheimer's disease. Cochrane Database Syst Rev. 2004;(2):CD004748.
REF 36 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004496)
REF 37 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000740)
REF 38 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006532)
REF 39 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006556)
REF 40 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6598).
REF 41 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028816)
REF 42 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001724)
REF 43 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001320)
REF 44 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020145)
REF 45 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001855)
REF 46 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028783)
REF 47 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012344)
REF 48 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015422)
REF 49 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007119)
REF 50 PD 142676 (CI 1002), a novel anticholinesterase and muscarinic antagonist. Mol Neurobiol. 1994 Aug-Dec;9(1-3):93-106.
REF 51 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004498)
REF 52 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006757)
REF 53 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006922)
REF 54 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007171)
REF 55 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017551)
REF 56 A novel acetylcholinesterase inhibitor, Ro 46-5934, which interacts with muscarinic M2 receptors. Biochem Soc Trans. 1994 Aug;22(3):755-8.
REF 57 Alpha6-containing nicotinic acetylcholine receptors dominate the nicotine control of dopamine neurotransmission in nucleus accumbens. Neuropsychopharmacology. 2008 Aug;33(9):2158-66.
REF 58 The effects of topical ocular application of 0.25% demecarium bromide on serum acetylcholinesterase levels in normal dogs. Vet Ophthalmol. 2003 Mar;6(1):23-5.
REF 59 Neuromuscular blocking agents and axial teratogenesis in the avian embryo. Can axial morphogenetic disorders by explained by pharmacological action upon muscle tissue Teratology. 1981 Apr;23(2):259-71.
REF 60 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
REF 61 Screening of acetylcholinesterase inhibitors by CE after enzymatic reaction at capillary inlet. J Sep Sci. 2009 May;32(10):1748-56.
REF 62 Neuromuscular blockade, reversal agent use, and operating room time: retrospective analysis of US inpatient surgeries. Curr Med Res Opin. 2009 Apr;25(4):943-50.
REF 63 Stabilization of Torpedo californica acetylcholinesterase by reversible inhibitors. Biochemistry. 2009 Jan 27;48(3):563-74.
REF 64 [From symptomatic to disease modifying therapy Recent developments in the pharmacotherapy of Alzheimer's disease]. Fortschr Neurol Psychiatr. 2009 Jun;77(6):326-33.
REF 65 Effects of cholinesterase inhibition on brain white matter volume in Alzheimer's disease. Neuroreport. 2009 Feb 18;20(3):285-8.
REF 66 Acetylcholinesterase inhibitors enhance cognitive functions in rats following hypobaric hypoxia. Behav Brain Res. 2009 Oct 12;203(1):1-14.
REF 67 Huperzine A attenuates cognitive deficits and brain injury in neonatal rats after hypoxia-ischemia. Brain Res. 2002 Sep 13;949(1-2):162-70.
REF 68 Rational design of alkylene-linked bis-pyridiniumaldoximes as improved acetylcholinesterase reactivators. Chem Biol. 2003 Jun;10(6):491-502.
REF 69 Acetylcholinesterase activity in Corbicula fluminea Mull., as a biomarker of organophosphate pesticide pollution in Pinacanauan River, Philippines. Environ Monit Assess. 2010 Jun;165(1-4):331-40.
REF 70 Evidence that the clinical effects of cholinesterase inhibitors are related to potency and targeting of action. Int J Clin Pract Suppl. 2002 Jun;(127):6-19.
REF 71 Long-acting anticholinesterases for myasthenia gravis: synthesis and activities of quaternary phenylcarbamates of neostigmine, pyridostigmine and physostigmine. Bioorg Med Chem. 2010 Jul 1;18(13):4687-93.
REF 72 Activity, mechanism of action and pharmacokinetics of 2-tert-butylbenzothiazole and CGP 6140 (amocarzine) antifilarial drugs. Acta Trop. 1992 Aug;51(3-4):195-211.
REF 73 Novel carbamates as orally active acetylcholinesterase inhibitors found to improve scopolamine-induced cognition impairment: pharmacophore-based vi... J Med Chem. 2010 Sep 9;53(17):6490-505.
REF 74 The memory ameliorating effects of INM-176, an ethanolic extract of Angelica gigas, against scopolamine- or Abeta(1-42)-induced cognitive dysfunction in mice. J Ethnopharmacol. 2012 Sep 28;143(2):611-20.
REF 75 Potential clinical use of an adrenergic/cholinergic agent (HP 128) in the treatment of Alzheimer's disease. Ann N Y Acad Sci. 1991;640:263-7.
REF 76 A randomized phase I study of methanesulfonyl fluoride, an irreversible cholinesterase inhibitor, for the treatment of Alzheimer's disease. Br J Clin Pharmacol. 2013 May;75(5):1231-9.
REF 77 An overview of phenserine tartrate, a novel acetylcholinesterase inhibitor for the treatment of Alzheimer's disease. Curr Alzheimer Res. 2005 Jul;2(3):281-90.
REF 78 Preclinical and first-in-human evaluation of PRX-105, a PEGylated, plant-derived, recombinant human acetylcholinesterase-R. Toxicol Appl Pharmacol. 2015 Sep 15;287(3):202-9.
REF 79 A sensitive method for the determination of the novel cholinesterase inhibitor ZT-1 and its active metabolite huperzine A in rat blood using liquid chromatography/tandem mass spectrometry. Rapid Commun Mass Spectrom. 2004;18(6):651-6.
REF 80 Recent advances in acetylcholinesterase Inhibitors and Reactivators: an update on the patent literature (2012-2015).Expert Opin Ther Pat. 2017 Apr;27(4):455-476.
REF 81 A patent review of butyrylcholinesterase inhibitors and reactivators 2010-2017.Expert Opin Ther Pat. 2018 Jun;28(6):455-465.
REF 82 Synthesis and biological activity of putative mono-hydroxylated metabolites of velnacrine, Bioorg. Med. Chem. Lett. 2(8):865-870 (1992).
REF 83 Effect of oral administration of zanapezil (TAK-147) for 21 days on acetylcholine and monoamines levels in the ventral hippocampus of freely moving rats. Br J Pharmacol. 2005 Aug;145(8):1035-44.
REF 84 Biochemical pharmacology of N-acetyl-N-(methylcarbamoyloxy)-N'-methylurea (caracemide; NSC-253272). Biochem Pharmacol. 1986 Aug 15;35(16):2781-7.
REF 85 NXX-066 in patients with Alzheimer's disease: a bridging study. Life Sci. 1999;64(14):1215-21.
REF 86 A docking score function for estimating ligand-protein interactions: application to acetylcholinesterase inhibition. J Med Chem. 2004 Oct 21;47(22):5492-500.
REF 87 The effects of physostigmine on acetylcholinesterase activity of CSF plasma and brain. A comparison of intravenous and intraventricular administration in beagle dogs. Neuropharmacology. 1986 Oct;25(10):1167-77.
REF 88 Xanthine derivatives IBMX and S-9977-2 potentiate transmission at an Aplysia central cholinergic synapse. Brain Res. 1992 Jul 17;586(1):78-85.
REF 89 Pharmacological and biochemical assessment of SM-10888, a novel cholinesterase inhibitor. Jpn J Pharmacol. 1990 Jun;53(2):145-55.
REF 90 Effects of TAK-802, a novel acetylcholinesterase inhibitor, on distension-induced rhythmic bladder contractions in rats and guinea pigs. Eur J Pharmacol. 2004 Feb 6;485(1-3):299-305.
REF 91 Acetylcholinesterase inhibition by zifrosilone: pharmacokinetics and pharmacodynamics. Clin Pharmacol Ther. 1995 Jul;58(1):54-61.
REF 92 Potent beta-amyloid modulators. Neurodegener Dis. 2008;5(3-4):153-6.
REF 93 Galantamine, a cholinesterase inhibitor that allosterically modulates nicotinic receptors: effects on the course of Alzheimer's disease. Biol Psychiatry. 2001 Feb 1;49(3):289-99.
REF 94 Synthesis and in vitro evaluation of N-alkyl-7-methoxytacrine hydrochlorides as potential cholinesterase inhibitors in Alzheimer disease. Bioorg Med Chem Lett. 2010 Oct 15;20(20):6093-5.
REF 95 Novel tacrine analogues for potential use against Alzheimer's disease: potent and selective acetylcholinesterase inhibitors and 5-HT uptake inhibitors. J Med Chem. 1997 Oct 24;40(22):3516-23.
REF 96 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004498)
REF 97 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006757)
REF 98 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006922)
REF 99 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
REF 100 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017551)
REF 101 Binding of 13-amidohuprines to acetylcholinesterase: exploring the ligand-induced conformational change of the gly117-gly118 peptide bond in the ox... J Med Chem. 2006 Nov 16;49(23):6833-40.
REF 102 Exploiting protein fluctuations at the active-site gorge of human cholinesterases: further optimization of the design strategy to develop extremely... J Med Chem. 2008 Jun 12;51(11):3154-70.
REF 103 Structure-based alignment and comparative molecular field analysis of acetylcholinesterase inhibitors. J Med Chem. 1996 Dec 20;39(26):5064-71.
REF 104 Isolation and cholinesterase-inhibition studies of sterols from Haloxylon recurvum. Bioorg Med Chem Lett. 2006 Feb;16(3):573-80.
REF 105 Synthesis and AChE inhibitory activity of new chiral tetrahydroacridine analogues from terpenic cyclanones. Eur J Med Chem. 2010 Feb;45(2):526-35.
REF 106 Preparation and in vitro screening of symmetrical bispyridinium cholinesterase inhibitors bearing different connecting linkage-initial study for My... Bioorg Med Chem Lett. 2010 Mar 1;20(5):1763-6.
REF 107 Synthesis and biological evaluation of a new series of berberine derivatives as dual inhibitors of acetylcholinesterase and butyrylcholinesterase. Bioorg Med Chem. 2010 Jun 15;18(12):4475-84.
REF 108 Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. J Med Chem. 2007 Nov 15;50(23):5727-34.
REF 109 Efficient method for high-throughput virtual screening based on flexible docking: discovery of novel acetylcholinesterase inhibitors. J Med Chem. 2004 Sep 23;47(20):4818-28.
REF 110 A structure-based design approach to the development of novel, reversible AChE inhibitors. J Med Chem. 2001 Sep 27;44(20):3203-15.
REF 111 Active site directed docking studies: synthesis and pharmacological evaluation of cis-2,6-dimethyl piperidine sulfonamides as inhibitors of acetylc... Eur J Med Chem. 2009 Oct;44(10):4057-62.
REF 112 Acetylcholinesterase inhibitors from the toadstool Cortinarius infractus. Bioorg Med Chem. 2010 Mar 15;18(6):2173-2177.
REF 113 Homobivalent quinazolinimines as novel nanomolar inhibitors of cholinesterases with dirigible selectivity toward butyrylcholinesterase. J Med Chem. 2006 Sep 7;49(18):5411-3.
REF 114 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
REF 115 Acetylcholinesterase inhibition by alkaloids of the ant's venom Monomorium minutum, Bioorg. Med. Chem. Lett. 5(11):1131-1132 (1995).
REF 116 Design, synthesis and evaluation of 2,4-disubstituted pyrimidines as cholinesterase inhibitors. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3606-9.
REF 117 Bivalent beta-carbolines as potential multitarget anti-Alzheimer agents. J Med Chem. 2010 May 13;53(9):3611-7.
REF 118 Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. J Med Chem. 2005 Apr 21;48(8):2906-15.
REF 119 Synthesis, anticholinesterase activity and structure-activity relationships of m-Aminobenzoic acid derivatives. Bioorg Med Chem Lett. 2003 May 19;13(10):1825-7.
REF 120 Synthesis and evaluation of novel rutaecarpine derivatives and related alkaloids derivatives as selective acetylcholinesterase inhibitors. Eur J Med Chem. 2010 Apr;45(4):1415-23.
REF 121 Design, synthesis, and acetylcholinesterase inhibitory activity of novel coumarin analogues. Bioorg Med Chem. 2008 Sep 1;16(17):8011-21.
REF 122 Homo- and hetero-bivalent edrophonium-like ammonium salts as highly potent, dual binding site AChE inhibitors. Bioorg Med Chem. 2008 Aug 1;16(15):7450-6.
REF 123 Cholinesterase inhibitors: SAR and enzyme inhibitory activity of 3-[omega-(benzylmethylamino)alkoxy]xanthen-9-ones. Bioorg Med Chem. 2007 Jan 1;15(1):575-85.
REF 124 Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
REF 125 Synthesis and biological evaluation of helicid analogues as novel acetylcholinesterase inhibitors. Eur J Med Chem. 2008 Jan;43(1):166-73.
REF 126 Design, synthesis, evaluation and QSAR analysis of N(1)-substituted norcymserine derivatives as selective butyrylcholinesterase inhibitors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1718-20.
REF 127 Synthesis, in vitro assay, and molecular modeling of new piperidine derivatives having dual inhibitory potency against acetylcholinesterase and Abe... Bioorg Med Chem. 2007 Oct 15;15(20):6596-607.
REF 128 Structure and anti-acetylcholinesterase activity of 4 alpha-(hydroxymethyl)-4 alpha-demethylterritrem B. J Nat Prod. 1997 Aug;60(8):842-3.
REF 129 The synthesis and in vitro acetylcholinesterase and butyrylcholinesterase inhibitory activity of tacrine (Cognex ) derivaties, Bioorg. Med. Chem. Lett. 2(8):861-864 (1992).
REF 130 Novel and potent tacrine-related hetero- and homobivalent ligands for acetylcholinesterase and butyrylcholinesterase. Bioorg Med Chem Lett. 2001 Jul 9;11(13):1779-82.
REF 131 Pyrano[3,2-c]quinoline-6-chlorotacrine hybrids as a novel family of acetylcholinesterase- and beta-amyloid-directed anti-Alzheimer compounds. J Med Chem. 2009 Sep 10;52(17):5365-79.
REF 132 6-Hydroxy- and 6-methoxy-beta-carbolines as acetyl- and butyrylcholinesterase inhibitors. Bioorg Med Chem Lett. 2006 Nov 15;16(22):5840-3.
REF 133 Synthesis, biological evaluation and molecular modeling of oxoisoaporphine and oxoaporphine derivatives as new dual inhibitors of acetylcholinester... Eur J Med Chem. 2009 Jun;44(6):2523-32.
REF 134 Novel heterobivalent tacrine derivatives as cholinesterase inhibitors with notable selectivity toward butyrylcholinesterase. J Med Chem. 2006 Dec 14;49(25):7540-4.
REF 135 Synthesis, biological evaluation, and molecular modeling of berberine derivatives as potent acetylcholinesterase inhibitors. Bioorg Med Chem. 2010 Feb;18(3):1244-51.
REF 136 Potent acetylcholinesterase inhibitors: design, synthesis and structure-activity relationships of alkylene linked bis-galanthamine and galanthamine... Bioorg Med Chem Lett. 2000 Apr 3;10(7):637-9.
REF 137 Targeting Alzheimer's disease: Novel indanone hybrids bearing a pharmacophoric fragment of AP2238. Bioorg Med Chem. 2010 Mar 1;18(5):1749-60.
REF 138 Multi-target-directed coumarin derivatives: hAChE and BACE1 inhibitors as potential anti-Alzheimer compounds. Bioorg Med Chem Lett. 2008 Jan 1;18(1):423-6.
REF 139 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.
REF 140 Bis-huperzine B: highly potent and selective acetylcholinesterase inhibitors. J Med Chem. 2005 Feb 10;48(3):655-7.
REF 141 Cholinesterases: new roles in brain function and in Alzheimer's disease. Neurochem Res. 2003 Apr;28(3-4):515-22.
REF 142 Isosorbide-2-carbamate esters: potent and selective butyrylcholinesterase inhibitors. J Med Chem. 2008 Oct 23;51(20):6400-9.
REF 143 Structure-activity relationships of acetylcholinesterase noncovalent inhibitors based on a polyamine backbone. 4. Further investigation on the inne... J Med Chem. 2008 Nov 27;51(22):7308-12.
REF 144 Carinatumins A-C, new alkaloids from Lycopodium carinatum inhibiting acetylcholinesterase. Bioorg Med Chem. 2007 Feb 15;15(4):1703-7.
REF 145 Structural determinants of Torpedo californica acetylcholinesterase inhibition by the novel and orally active carbamate based anti-alzheimer drug g... J Med Chem. 2006 Aug 24;49(17):5051-8.
REF 146 Activation of the endocannabinoid system by organophosphorus nerve agents. Nat Chem Biol. 2008 Jun;4(6):373-8.
REF 147 Synthesis of the novel series of bispyridinium compounds bearing (E)-but-2-ene linker and evaluation of their reactivation activity against chlorpy... Bioorg Med Chem Lett. 2006 Feb;16(3):622-7.
REF 148 Indole alkaloids from Ervatamia hainanensis with potent acetylcholinesterase inhibition activities. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6185-7.
REF 149 PET imaging of brain acetylcholinesterase using [11C]CP-126,998, a brain selective enzyme inhibitor. Synapse. 2002 Jul;45(1):1-9.
REF 150 Cryptadines A and B, novel C27N3-type pentacyclic alkaloids from Lycopodium cryptomerinum. Bioorg Med Chem. 2007 Dec 15;15(24):7803-8.
REF 151 Synthesis and structure-activity relationship of Huprine derivatives as human acetylcholinesterase inhibitors. Bioorg Med Chem. 2009 Jul 1;17(13):4523-36.
REF 152 Synthesis and pharmacological evaluation of huprine-tacrine heterodimers: subnanomolar dual binding site acetylcholinesterase inhibitors. J Med Chem. 2005 Mar 24;48(6):1701-4.
REF 153 Isosorbide-based cholinesterase inhibitors; replacement of 5-ester groups leading to increased stability. Bioorg Med Chem. 2010 Feb;18(3):1045-53.
REF 154 Toward a rational design of multitarget-directed antioxidants: merging memoquin and lipoic acid molecular frameworks. J Med Chem. 2009 Dec 10;52(23):7883-6.
REF 155 Characterization of Acetylcholinesterase Inhibitory Constituents from Annona glabra Assisted by HPLC Microfractionation. J Nat Prod. 2010 Oct 22;73(10):1632-5.
REF 156 4-Phenylcoumarins from Mesua elegans with acetylcholinesterase inhibitory activity. Bioorg Med Chem. 2010 Nov 15;18(22):7873-7.
REF 157 Bis-(-)-nor-meptazinols as novel nanomolar cholinesterase inhibitors with high inhibitory potency on amyloid-beta aggregation. J Med Chem. 2008 Apr 10;51(7):2027-36.
REF 158 N-Alkylated galanthamine derivatives: Potent acetylcholinesterase inhibitors from Leucojum aestivum. Bioorg Med Chem Lett. 2008 Apr 1;18(7):2263-6.
REF 159 Litebamine N-homologues: preparation and anti-acetylcholinesterase activity. J Nat Prod. 1998 Jan;61(1):46-50.
REF 160 Differential binding of phenothiazine urea derivatives to wild-type human cholinesterases and butyrylcholinesterase mutants. Bioorg Med Chem. 2010 Mar 15;18(6):2232-2244.
REF 161 Petrosamine, a potent anticholinesterase pyridoacridine alkaloid from a Thai marine sponge Petrosia n. sp. Bioorg Med Chem. 2008 Jul 1;16(13):6560-7.
REF 162 Taspine: bioactivity-guided isolation and molecular ligand-target insight of a potent acetylcholinesterase inhibitor from Magnolia x soulangiana. J Nat Prod. 2006 Sep;69(9):1341-6.
REF 163 Acetylcholinesterase inhibition by territrem B derivatives. J Nat Prod. 1995 Jun;58(6):857-62.
REF 164 Multi-target-directed ligands to combat neurodegenerative diseases. J Med Chem. 2008 Feb 14;51(3):347-72.
REF 165 Indole glucoalkaloids from Chimarrhis turbinata and their evaluation as antioxidant agents and acetylcholinesterase inhibitors. J Nat Prod. 2004 Nov;67(11):1882-5.
REF 166 Acetylcholinesterase inhibitors: synthesis and structure-activity relationships of omega-[N-methyl-N-(3-alkylcarbamoyloxyphenyl)- methyl]aminoalkox... J Med Chem. 1998 Oct 8;41(21):3976-86.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.