Target General Infomation
Target ID
T37539 (Former ID: TTDS00480)
Target Name
B-cell receptor CD22 (CD22)
Synonyms
T-cell surface antigen Leu-14; Siglec-2; Sialic acid-binding Ig-like lectin 2; SIGLEC2; Leu-14; BL-CAM; B-lymphocyte cell adhesion molecule
Gene Name
CD22
Target Type
Successful target
[1]
Disease [+] 4 Target-related Diseases +
1 Lyme borreliosis [ICD-11: 1C1G]
2 Malignant haematopoietic neoplasm [ICD-11: 2B33]
3 Mature B-cell leukaemia [ICD-11: 2A82]
4 Mature B-cell lymphoma [ICD-11: 2A85]
Function
May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. Mediates B-cell B-cell interactions.
BioChemical Class
Immunoglobulin
UniProt ID
CD22_HUMAN
Sequence
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR
MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG
VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH
TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT
KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL
PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT
TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ
FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM
SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ
GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG
LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES
SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV
DYVILKH
Drugs and Modes of Action
Approved Drug(s) [+] 4 Approved Drugs +
1 Inotuzumab ozogamicin Drug Info Approved Acute lymphocytic leukaemia [2]
2 Moxetumomab pasudotox Drug Info Approved Hairy cell leukaemia [3]
3 Moxetumomab pasudotox Drug Info Approved Hairy cell leukaemia [4]
4 OspA lipoprotein Drug Info Approved Lyme disease [5]
Clinical Trial Drug(s) [+] 34 Clinical Trial Drugs +
1 Epratuzumab Drug Info Phase 3 Graft rejection in heart transplantation [6], [7]
2 BL-22 Drug Info Phase 2 Acute lymphoblastic leukaemia [8]
3 CAR-T cells targeting CD22 Drug Info Phase 2 Non-hodgkin lymphoma [9]
4 4SCAR19 and 4SCAR22 Drug Info Phase 1/2 B-cell lymphoma [10]
5 4SCAR19/22 T cells Drug Info Phase 1/2 B-cell lymphoma [11]
6 Anti-CD19/22-CAR vector-transduced T cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [12]
7 Anti-CD22 CAR-T cells Drug Info Phase 1/2 leukaemia [13]
8 Anti-CD22-CAR-transduced T cells Drug Info Phase 1/2 leukaemia [14]
9 AUTO3 Drug Info Phase 1/2 Acute lymphoblastic leukaemia [15]
10 CAR-T cells targeting CD22 Drug Info Phase 1/2 leukaemia [16]
11 CART-19/22 Drug Info Phase 1/2 leukaemia [17]
12 CD19 and CD22 CAR-T Cells Drug Info Phase 1/2 Lymphoma [18]
13 CD19 and CD22 CAR-T Cells Drug Info Phase 1/2 B-cell lymphoma [19]
14 CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells Drug Info Phase 1/2 Haematopoietic/lymphoid cancer [20]
15 CD22 CAR-T Drug Info Phase 1/2 B-cell lymphoma [21]
16 CD22-Targeted CAR-T cells Drug Info Phase 1/2 leukaemia [22]
17 Anti-CD22 Drug Info Phase 1 Haematological malignancy [23]
18 Anti-CD22 CAR-T cells Drug Info Phase 1 leukaemia [24]
19 CART-22 cells Drug Info Phase 1 Acute lymphoblastic leukaemia [25]
20 CART22 cells Drug Info Phase 1 Acute lymphoblastic leukaemia [26]
21 CART22 cells expressing anti-CD22 scFv TCRz:41BB Drug Info Phase 1 Acute lymphoblastic leukaemia [27]
22 CART22-65s cells Drug Info Phase 1 Acute lymphoblastic leukaemia [28]
23 CART22-65s cells and huCART19 Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [28]
24 CD19/CD22 CAR T cells Drug Info Phase 1 Acute lymphoblastic leukaemia [29]
25 CD19/CD22 CAR T-Cells Drug Info Phase 1 Acute lymphocytic leukaemia [30]
26 CD19/CD22 Chimeric Antigen Receptor T Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [31]
27 CD22-CART Drug Info Phase 1 leukaemia [32]
28 CD22-specific CAR T-cells also expressing an EGFRt Drug Info Phase 1 leukaemia [33]
29 Combotox Drug Info Phase 1 leukaemia [34]
30 Donor-derived CD19/22 bispecific CAR-T cells Drug Info Phase 1 leukaemia [35]
31 Dual Specificity CD19 and CD22 CAR-T Cell Drug Info Phase 1 B-cell lymphoma [36]
32 JCAR018 Drug Info Phase 1 Acute lymphoblastic leukaemia [37]
33 Patient-derived CD19- and CD22 specific CAR Drug Info Phase 1 leukaemia [38]
34 Retroviral vector-transduced autologous T cells to express CD22-specific CARs Drug Info Phase 1 Diffuse large B-cell lymphoma [39]
Discontinued Drug(s) [+] 2 Discontinued Drugs +
1 DCDT-2980S Drug Info Discontinued in Phase 2 Diffuse large B-cell lymphoma [40]
2 RG7593 Drug Info Discontinued in Phase 2 Haematological malignancy [40]
Preclinical Drug(s) [+] 1 Preclinical Drugs +
1 Targeted ranpirnase conjugates Drug Info Preclinical Solid tumour/cancer [41]
Mode of Action [+] 5 Modes of Action +
Modulator [+] 5 Modulator drugs +
1 Moxetumomab pasudotox Drug Info [43]
2 Moxetumomab pasudotox Drug Info [4]
3 Combotox Drug Info [46]
4 RG7593 Drug Info [48]
5 Anti-CD22/CD19 mab-toxin conjugate Drug Info [50]
Binder [+] 1 Binder drugs +
1 OspA lipoprotein Drug Info [1]
CAR-T-Cell-Therapy [+] 13 CAR-T-Cell-Therapy drugs +
1 CAR-T cells targeting CD22 Drug Info [9]
2 Anti-CD22 CAR-T cells Drug Info [13]
3 Anti-CD22-CAR-transduced T cells Drug Info [14]
4 CAR-T cells targeting CD22 Drug Info [16]
5 CD22 CAR-T Drug Info [21]
6 CD22-Targeted CAR-T cells Drug Info [22]
7 Anti-CD22 CAR-T cells Drug Info [24]
8 CART-22 cells Drug Info [25]
9 CART22 cells Drug Info [26]
10 CART22 cells expressing anti-CD22 scFv TCRz:41BB Drug Info [27]
11 CART22-65s cells Drug Info [28]
12 CD22-specific CAR T-cells also expressing an EGFRt Drug Info [33]
13 Retroviral vector-transduced autologous T cells to express CD22-specific CARs Drug Info [39]
CAR-T-Cell-Therapy(Dual specific) [+] 16 CAR-T-Cell-Therapy(Dual specific) drugs +
1 4SCAR19 and 4SCAR22 Drug Info [10]
2 4SCAR19/22 T cells Drug Info [11]
3 Anti-CD19/22-CAR vector-transduced T cells Drug Info [12]
4 AUTO3 Drug Info [15], [45]
5 CART-19/22 Drug Info [17]
6 CD19 and CD22 CAR-T Cells Drug Info [18]
7 CD19 and CD22 CAR-T Cells Drug Info [19]
8 CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells Drug Info [20]
9 CART22-65s cells and huCART19 Cells Drug Info [28]
10 CD19/CD22 CAR T cells Drug Info [29]
11 CD19/CD22 CAR T-Cells Drug Info [30]
12 CD19/CD22 Chimeric Antigen Receptor T Cells Drug Info [31]
13 CD22-CART Drug Info [32]
14 Donor-derived CD19/22 bispecific CAR-T cells Drug Info [35]
15 Dual Specificity CD19 and CD22 CAR-T Cell Drug Info [36]
16 Patient-derived CD19- and CD22 specific CAR Drug Info [38]
Immunomodulator [+] 1 Immunomodulator drugs +
1 JCAR018 Drug Info [37]
Target Regulators
Target-regulating microRNAs
Target-interacting Proteins
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 3 KEGG Pathways +
1 Cell adhesion molecules (CAMs)
2 Hematopoietic cell lineage
3 B cell receptor signaling pathway
Panther Pathway [+] 1 Panther Pathways +
1 B cell activation
PID Pathway [+] 1 PID Pathways +
1 BCR signaling pathway
Reactome [+] 2 Reactome Pathways +
1 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
2 Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
WikiPathways [+] 1 WikiPathways +
1 B Cell Receptor Signaling Pathway
Target-Related Models and Studies
Target Validation
References
REF 1 Safety and immunogenicity of recombinant Bacille Calmette-Gu |rin (rBCG) expressing Borrelia burgdorferi outer surface protein A (OspA) lipoprotein in adult volunteers: a candidate Lyme disease vaccine. Vaccine. 1999 Feb 26;17(7-8):904-14.
REF 2 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85.
REF 3 FDA Approved Drug Products from FDA Official Website. 2018. Application Number: (ANDA) 761104.
REF 4 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89.
REF 5 Infection of mice with lyme disease spirochetes constitutively producing outer surface proteins a and B. Infect Immun. 2007 Jun;75(6):2786-94.
REF 6 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8088).
REF 7 New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
REF 8 ClinicalTrials.gov (NCT00924040) Retreatment Protocol for BL22 Immunotherapy in Relapsed or Refractory Hairy Cell Leukemia. U.S. National Institutes of Health.
REF 9 ClinicalTrials.gov (NCT03196830) CAR-T for R/R B-NHL
REF 10 ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
REF 11 ClinicalTrials.gov (NCT03098355) Interleukin-2 Following 4SCAR19/22 T Cells Targeting Refractory and/or Recurrent B Cell Malignancies
REF 12 ClinicalTrials.gov (NCT03185494) Treatment of Relapsed and/or Chemotherapy Refractory B-cell Malignancy by Tandem CAR T Cells Targeting CD19 and CD22
REF 13 ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
REF 14 ClinicalTrials.gov (NCT03262298) Anti-CD22 CAR-T Cell Therapy Targeting B Cell Malignancies
REF 15 ClinicalTrials.gov (NCT03289455) CD19 /22 CAR T Cells (AUTO3) for the Treatment of B Cell ALL
REF 16 ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 17 ClinicalTrials.gov (NCT03614858) CD19/CD22-targeted Chimeric Antigen Receptor Engineered T Cell (CART) in B-Cell Acute Lymphoblastic Leukemia.
REF 18 ClinicalTrials.gov (NCT03468153) Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Relapsed and Refractory Lymphoma
REF 19 ClinicalTrials.gov (NCT03398967) A Feasibility and Safety Study of Universal Dual Specificity CD19 and CD20 or CD22 CAR-T Cell Immunotherapy for Relapsed or Refractory Leukemia and Lymphoma
REF 20 ClinicalTrials.gov (NCT02903810) Combination Transfer of CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells for B-cell Hematologic Malignancy
REF 21 ClinicalTrials.gov (NCT02794961) CD22 Targeting CAR-T Therapy Against B Cell Hematological Malignancies
REF 22 ClinicalTrials.gov (NCT02935153) A Clinical Research of CD22-Targeted CAR-T in B Cell Malignancies
REF 23 2011 Pipeline of Seattle Genetics.
REF 24 ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 25 ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
REF 26 ClinicalTrials.gov (NCT02588456) Pilot Study of Autologous Anti-CD22 Chimeric Antigen Receptor Redirected T Cells In Patients With Chemotherapy Resistant Or Refractory Acute Lymphoblastic Leukemia
REF 27 ClinicalTrials.gov (NCT02650414) CD22 Redirected Autologous T Cells for ALL
REF 28 ClinicalTrials.gov (NCT03620058) CART22 Alone or in Combination With huCART19 for ALL
REF 29 ClinicalTrials.gov (NCT03241940) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Children or Young Adults With Recurrent or Refractory CD19 Positive B Acute Lymphoblastic Leukemia
REF 30 ClinicalTrials.gov (NCT03448393) CD19/CD22 Chimeric Antigen Receptor (CAR) T Cells in Children and Young Adults With Recurrent or Refractory CD19/CD22-expressing B Cell Malignancies
REF 31 ClinicalTrials.gov (NCT03233854) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Patients With Recurrent or Refractory CD19 Positive Diffuse Large B-Cell Lymphoma or B Acute Lymphoblastic Leukemia
REF 32 ClinicalTrials.gov (NCT03407859) Sequential Treatment With CD20/CD22/CD10-CART After CD19-CART Treatment Base on MRD in Relapsed/Refractory B-ALL
REF 33 ClinicalTrials.gov (NCT03244306) A Phase 1 Study of CD22-CAR TCell Immunotherapy for CD22+ Leukemia and Lymphoma
REF 34 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936)
REF 35 ClinicalTrials.gov (NCT03463928) A Feasibility and Safety Study of Concomitant Therapy With Allo-CAR-T Cells and Allo-HSCT in Patients With Relapse or Refractory Leukemia
REF 36 ClinicalTrials.gov (NCT03593109) Safety and Efficacy Study of Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy in Relapsed or Refractory Lymphoma
REF 37 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 38 ClinicalTrials.gov (NCT03330691) A Feasibility and Safety Study of Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Leukemia and Lymphoma
REF 39 ClinicalTrials.gov (NCT02721407) Anti-CD22 CAR-T Therapy for CD19-refractory or Resistant Lymphoma Patients
REF 40 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027651)
REF 41 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021480)
REF 42 Results of inotuzumab ozogamicin, a CD22 monoclonal antibody, in refractory and relapsed acute lymphocytic leukemia. Cancer. 2013 Aug 1;119(15):2728-36.
REF 43 Antibody fusion proteins: anti-CD22 recombinant immunotoxin moxetumomab pasudotox. Clin Cancer Res. 2011 Oct 15;17(20):6398-405.
REF 44 Anti-CD22 immunotoxin RFB4(dsFv)-PE38 (BL22) for CD22-positive hematologic malignancies of childhood: preclinical studies and phase I clinical trial. Clin Cancer Res. 2010 Mar 15;16(6):1894-903.
REF 45 ClinicalTrials.gov (NCT03287817) CD19/22 CAR T Cells (AUTO3) for the Treatment of Diffuse Large B Cell Lymphoma
REF 46 A phase I study of a combination of anti-CD19 and anti-CD22 immunotoxins (Combotox) in adult patients with refractory B-lineage acute lymphoblastic leukaemia.Br J Haematol.2011 Aug;154(4):471-6.
REF 47 Efficacy and toxicity of a CD22-targeted antibody-saporin conjugate in a xenograft model of non-Hodgkin's lymphoma. Oncoimmunology. 2012 December 1; 1(9): 1469-1475.
REF 48 Clinical pipeline report, company report or official report of Roche.
REF 49 Clinical pipeline report, company report or official report of Alfacell.
REF 50 Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8.
REF 51 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2786).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.