Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T44916
|
||||
| Target Name |
Embryonic ectoderm development protein (EED)
|
||||
| Synonyms |
hEED; WD protein associating with integrin cytoplasmic tails 1; WAIT-1
|
||||
| Gene Name |
EED
|
||||
| Target Type |
Clinical trial target
|
[1] | |||
| Disease | [+] 1 Target-related Diseases | + | |||
| 1 | Diffuse large B-cell lymphoma [ICD-11: 2A81] | ||||
| Function |
Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Also recognizes 'Lys-26' trimethylated histone H1 with the effect of inhibiting PRC2 complex methyltransferase activity on nucleosomal histone H3 'Lys-27', whereas H3 'Lys-27' recognition has the opposite effect, enabling the propagation of this repressive mark. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
|
||||
| UniProt ID | |||||
| Sequence |
MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTP
NAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNR VTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITM QCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVL SADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS TRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQ CDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR DSSILIAVCDDASIWRWDRLR |
||||
| Drugs and Modes of Action | |||||
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | |||
| 1 | MAK683 | Drug Info | Phase 1/2 | Diffuse large B-cell lymphoma | [1] |
| Mode of Action | [+] 1 Modes of Action | + | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | |||
| 1 | MAK683 | Drug Info | [1] | ||
| Target Regulators | |||||
| Target-interacting Proteins | |||||
| References | |||||
| REF 1 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.