Target Information

Target General Infomation
Target ID
T56365 (Former ID: TTDC00135)
Target Name
B-lymphocyte surface antigen B4 (CD19)
Synonyms
T-cell surface antigen Leu-12; Leu-12; Differentiation antigen CD19; B-lymphocyte antigen CD19
Gene Name
CD19
Target Type
Successful target
 [1]
Disease [+] 2 Target-related Diseases +
1 Diffuse large B-cell lymphoma [ICD-11: 2A81]
2 Mature B-cell lymphoma [ICD-11: 2A85]
Function
Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores. Is not required for early steps during B cell differentiation in the blood marrow. Required for normal differentiation of B-1 cells. Required for normal B cell differentiation and proliferation in response to antigen challenges. Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge. Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes.
BioChemical Class
Immunoglobulin
UniProt ID
CD19_HUMAN
Sequence
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP
DPAWGGGGRMGTWSTR
Drugs and Modes of Action
Approved Drug(s) [+] 3 Approved Drugs +
1 Axicabtagene ciloleucel Drug Info Approved Diffuse large B-cell lymphoma [2]
2 Blinatumomab Drug Info Approved Acute lymphoblastic leukaemia [3], [4]
3 Tisagenlecleucel Drug Info Approved Acute lymphoblastic leukaemia [2]
Clinical Trial Drug(s) [+] 162 Clinical Trial Drugs +
1 CART-19 Drug Info Phase 2/3 Acute lymphoblastic leukaemia [5]
2 CD19 CAR T cells Drug Info Phase 2/3 Acute lymphoblastic leukaemia [6]
3 MOR-208 Drug Info Phase 2/3 Diffuse large B-cell lymphoma [7], [8], [9]
4 CAR-T cells targeting CD19 Drug Info Phase 2 Non-hodgkin lymphoma [10]
5 CART 19 Drug Info Phase 2 Acute lymphoblastic leukaemia [11], [12]
6 CART-19 Drug Info Phase 2 Non-hodgkin lymphoma [13]
7 CART-19 cells Drug Info Phase 2 Multiple myeloma [14]
8 CD19 CAR T cells Drug Info Phase 2 B-cell chronic lymphocytic leukaemia [15]
9 CD19-targeting CAR T cells Drug Info Phase 2 B-cell lymphoma [16], [17]
10 Coltuximab ravtansine Drug Info Phase 2 Diffuse large B-cell lymphoma [8]
11 CTL019 Drug Info Phase 2 Chronic lymphocytic leukaemia [18]
12 CTL019 Drug Info Phase 2 Diffuse large B-cell lymphoma [18], [19]
13 Inebilizumab Drug Info Phase 2 Neuromyelitis optica [20]
14 JCAR015 Drug Info Phase 2 B-cell lymphoma [21]
15 JCAR015 Drug Info Phase 2 Acute lymphoblastic leukaemia [21]
16 JCAR017 Drug Info Phase 2 Central nervous system lymphoma [22]
17 KYMRIAH Drug Info Phase 2 Acute lymphoblastic leukaemia [23]
18 MB-CART19.1 Drug Info Phase 2 Precursor B-lymphoblastic neoplasm [24]
19 MDX-1342 Drug Info Phase 2 leukaemia [25]
20 MEDI-551 Drug Info Phase 2 Encephalopathy [7]
21 SAR-3419 Drug Info Phase 2 Non-hodgkin lymphoma [26]
22 XLCART001 Drug Info Phase 2 B-cell lymphoma [27]
23 Xmab 5871 Drug Info Phase 2 Autoimmune diabetes [28]
24 YESCARTA Drug Info Phase 2 Diffuse large B-cell lymphoma [23]
25 4SCAR19 and 4SCAR123 Drug Info Phase 1/2 B-cell lymphoma [29]
26 4SCAR19 and 4SCAR20 Drug Info Phase 1/2 B-cell lymphoma [29]
27 4SCAR19 and 4SCAR22 Drug Info Phase 1/2 B-cell lymphoma [29]
28 4SCAR19 and 4SCAR30 Drug Info Phase 1/2 B-cell lymphoma [29]
29 4SCAR19 and 4SCAR38 Drug Info Phase 1/2 B-cell lymphoma [29]
30 4SCAR19 and 4SCAR70 Drug Info Phase 1/2 B-cell lymphoma [29]
31 4SCAR19 cells Drug Info Phase 1/2 B-cell lymphoma [30]
32 4SCAR19/22 T cells Drug Info Phase 1/2 B-cell lymphoma [31]
33 Anti-CD19 and Anti-CD20 CAR-T Cells Drug Info Phase 1/2 B-cell lymphoma [32]
34 Anti-CD19 CAR T cells Drug Info Phase 1/2 B-cell lymphoma [33], [34]
35 Anti-CD19 CAR transduced T cells Drug Info Phase 1/2 Acute lymphocytic leukaemia [35]
36 Anti-CD19 CAR-T Drug Info Phase 1/2 Haematopoietic/lymphoid cancer [36]
37 Anti-CD19 CAR-T cells Drug Info Phase 1/2 Acute lymphocytic leukaemia [37]
38 Anti-CD19 CAR-T cells Drug Info Phase 1/2 leukaemia [38]
39 Anti-CD19 CAR-T cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [39], [40]
40 Anti-CD19 CAR-T cells Drug Info Phase 1/2 B-cell chronic lymphocytic leukaemia [41]
41 Anti-CD19-CAR PBL Drug Info Phase 1/2 Mantle cell lymphoma [42]
42 Anti-CD19-CAR vector-transduced T cells Drug Info Phase 1/2 Mantle cell lymphoma [43], [44]
43 Anti-CD19-CAR-T cells Drug Info Phase 1/2 leukaemia [45]
44 Anti-CD19/22-CAR vector-transduced T cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [46]
45 Anti-CD20 CAR-T cells Drug Info Phase 1/2 Diffuse large B-cell lymphoma [47]
46 AUTO3 Drug Info Phase 1/2 Acute lymphoblastic leukaemia [48]
47 Autologous Anti-CD19CAR-4-1BB-CD3zeta-EGFRt-expressing T Lymphocytes Drug Info Phase 1/2 Acute lymphoblastic leukaemia [49]
48 Autologous CD19-targeting CAR T cells Drug Info Phase 1/2 leukaemia [50]
49 CAR-T cells targeting CD19 Drug Info Phase 1/2 leukaemia [51]
50 CARCIK-CD19 Drug Info Phase 1/2 Acute lymphocytic leukaemia [52]
51 CART-19 cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [53]
52 CART-19/22 Drug Info Phase 1/2 leukaemia [54]
53 CART-19/BCMA Drug Info Phase 1/2 Multiple myeloma [55]
54 CD19 and CD20 CAR-T Cells Drug Info Phase 1/2 B-cell lymphoma [56]
55 CD19 and CD22 CAR-T Cells Drug Info Phase 1/2 Lymphoma [57]
56 CD19 and CD22 CAR-T Cells Drug Info Phase 1/2 B-cell lymphoma [56]
57 CD19 CAR Gene Transduced T Lymphocytes Drug Info Phase 1/2 Non-hodgkin lymphoma [58]
58 CD19 CAR T Cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [59]
59 CD19 CAR T cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [60]
60 CD19 CAR-T Cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [61]
61 CD19 CAR-T lymphocytes Drug Info Phase 1/2 Acute lymphoblastic leukaemia [62]
62 CD19 CART Drug Info Phase 1/2 B-cell lymphoma [63]
63 CD19 CART Drug Info Phase 1/2 Acute lymphoblastic leukaemia [64]
64 CD19 specific CAR T cells Drug Info Phase 1/2 Acute leukaemia [65]
65 CD19 targeted chimeric antigen receptor T cells Drug Info Phase 1/2 B-cell lymphoma [66]
66 CD19-CAR T cell Drug Info Phase 1/2 Acute lymphoblastic leukaemia [67]
67 CD19-directed CAR-T cells Drug Info Phase 1/2 leukaemia [68]
68 CD19-targeting CAR T Cells Drug Info Phase 1/2 B-cell lymphoma [69]
69 CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells Drug Info Phase 1/2 Haematopoietic/lymphoid cancer [70]
70 CD19.CAR T Cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [71]
71 CD19.CAR-T cells Drug Info Phase 1/2 Diffuse large B-cell lymphoma [72]
72 Chimeric Antigen Receptor Modified T cells Targeting CD19 Drug Info Phase 1/2 leukaemia [73]
73 CLIC-1901 Drug Info Phase 1/2 Acute lymphoblastic leukaemia [74]
74 Humanized CD19 CAR-T cells Drug Info Phase 1/2 Acute lymphoblastic leukaemia [75]
75 IM19 CAR-T Drug Info Phase 1/2 leukaemia [76], [77]
76 JCAR014 Drug Info Phase 1/2 Non-hodgkin lymphoma [78]
77 JCAR017 Drug Info Phase 1/2 leukaemia [79]
78 JCAR017 Drug Info Phase 1/2 Chronic lymphocytic leukaemia [80], [81]
79 KTE-C19 CAR Drug Info Phase 1/2 Diffuse large B-cell lymphoma [82]
80 PBCAR0191 Drug Info Phase 1/2 Acute lymphoblastic leukaemia [83]
81 PCAR-019 (anti-CD19 CAR-T cells) Drug Info Phase 1/2 Acute lymphocytic leukaemia [84]
82 SCRI-huCAR19v1 Drug Info Phase 1/2 leukaemia [85]
83 SJCAR19 Drug Info Phase 1/2 Acute lymphoblastic leukaemia [86]
84 TBI-1501 Drug Info Phase 1/2 Acute lymphoblastic leukaemia [87]
85 TriCAR-T-CD19 Drug Info Phase 1/2 Non-hodgkin lymphoma [88]
86 UCART019 Drug Info Phase 1/2 B-cell lymphoma [89]
87 19-28z T CELLS Drug Info Phase 1 Non-hodgkin lymphoma [90]
88 4SCAR19 cells Drug Info Phase 1 Acute lymphoblastic leukaemia [91]
89 AFM-11 Drug Info Phase 1 Non-hodgkin lymphoma [92], [8]
90 Allogeneic CART-19 Drug Info Phase 1 leukaemia [93]
91 Anti-CD19 anti-CD20 Bispecific CAR-T Drug Info Phase 1 leukaemia [94]
92 Anti-CD19 CAR-T Drug Info Phase 1 Acute lymphoblastic leukaemia [95]
93 Anti-CD19 CAR-T cells Drug Info Phase 1 leukaemia [96]
94 Anti-CD19 CART Cells Drug Info Phase 1 Multiple myeloma [97]
95 Anti-CD19- CAR Drug Info Phase 1 Acute lymphoblastic leukaemia [98]
96 Anti-CD19-CAR T Drug Info Phase 1 leukaemia [99]
97 Anti-CD19-CAR T cells Drug Info Phase 1 B-cell lymphoma [100]
98 Anti-CD19/BCMA CAR-T cells Drug Info Phase 1 Multiple myeloma [101]
99 AntiCD19 CART Drug Info Phase 1 Non-hodgkin lymphoma [102]
100 ARI-0001 cells Drug Info Phase 1 leukaemia [103]
101 BCMA CART and huCART19 Drug Info Phase 1 Multiple myeloma [104]
102 C-CAR011 Drug Info Phase 1 Non-hodgkin lymphoma [105], [106]
103 CAR-20/19-T Cells Drug Info Phase 1 B-cell non-hodgkin lymphoma [107]
104 CAR-T cells targeting CD19 Drug Info Phase 1 Lymphoma [108]
105 CAR-T Cells targeting CD19 Drug Info Phase 1 Acute lymphoblastic leukaemia [109]
106 CAR19 T cells carrying cytoplasmic activated PD-1 Drug Info Phase 1 Non-hodgkin lymphoma [110]
107 CART-19 Drug Info Phase 1 B-cell lymphoma [111]
108 CART-19 Drug Info Phase 1 Acute lymphoblastic leukaemia [112]
109 CART-19 autologous T-cells Drug Info Phase 1 Lymphoma [113]
110 CART-19 cells Drug Info Phase 1 Acute lymphoblastic leukaemia [114]
111 CART-19 cells Drug Info Phase 1 Acute lymphoblastic leukaemia [115]
112 CART-19 T cells Drug Info Phase 1 Multiple myeloma [116]
113 CART-meso-19 T cells Drug Info Phase 1 Pancreatic cancer [117]
114 CART19 cell Drug Info Phase 1 B-cell prolymphocytic leukaemia [118]
115 CART22-65s cells and huCART19 Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [119]
116 CARTmeso/19 Drug Info Phase 1 Pancreatic cancer [120]
117 CD19 CAR T Drug Info Phase 1 Acute lymphoblastic leukaemia [121]
118 CD19 CAR T Cells Drug Info Phase 1 Acute lymphocytic leukaemia [122]
119 CD19 CAR T cells Drug Info Phase 1 Acute lymphoblastic leukaemia [123]
120 CD19 CAR T-cells Drug Info Phase 1 Non-hodgkin lymphoma [124]
121 CD19 CAR T-cells Drug Info Phase 1 Acute lymphoblastic leukaemia [125]
122 CD19 CAR-T cells Drug Info Phase 1 Acute lymphoblastic leukaemia [126]
123 CD19 CAR-T cells Drug Info Phase 1 Acute lymphoblastic leukaemia [127]
124 CD19 Redirected Autologous T Cells Drug Info Phase 1 Systemic lupus erythematosus [128]
125 CD19+ CAR T Cells Drug Info Phase 1 leukaemia [129]
126 CD19-CAR and CD28-CAR T Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [130]
127 CD19-CAR-T Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [131]
128 CD19-CAR-T2 Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [132]
129 CD19-directed CAR-T cells Drug Info Phase 1 Non-hodgkin lymphoma [133]
130 CD19-directed CAR-T cells Drug Info Phase 1 leukaemia [134]
131 CD19-targeted CART cells Drug Info Phase 1 leukaemia [135]
132 CD19-TriCAR-T Drug Info Phase 1 Non-hodgkin lymphoma [136]
133 CD19.CAR-aNKT cells Drug Info Phase 1 B-cell small lymphocytic lymphoma [137]
134 CD19/CD22 CAR T cells Drug Info Phase 1 Acute lymphoblastic leukaemia [138]
135 CD19/CD22 CAR T-Cells Drug Info Phase 1 Acute lymphocytic leukaemia [139]
136 CD19/CD22 Chimeric Antigen Receptor T Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [140]
137 CD19CAT-41BBZ CAR T-cells Drug Info Phase 1 Acute lymphoblastic leukaemia [141]
138 Combotox Drug Info Phase 1 leukaemia [142]
139 Donor-derived CD19/22 bispecific CAR-T cells Drug Info Phase 1 leukaemia [134]
140 Dual Specificity CD19 and CD22 CAR-T Cell Drug Info Phase 1 B-cell lymphoma [143]
141 Duvortuxizumab Drug Info Phase 1 B-cell lymphoma [9]
142 EGFRt/19-28z/4-1BBL CAR T cells Drug Info Phase 1 Chronic lymphocytic leukaemia [144]
143 HuCART19 Drug Info Phase 1 leukaemia [145]
144 Human CD19 targeted T Cells Drug Info Phase 1 Follicular lymphoma [146]
145 IC9-CAR19 cells Drug Info Phase 1 Acute lymphoblastic leukaemia [147], [148]
146 IC9-CAR19 T cells Drug Info Phase 1 B-cell lymphoma [149]
147 ICAR19 CAR-T cells Drug Info Phase 1 B-cell lymphoma [150]
148 IM19 Drug Info Phase 1 Haematological malignancy [151]
149 JCAR014 Drug Info Phase 1 B-cell lymphoma [152]
150 JWCAR029 Drug Info Phase 1 Non-hodgkin lymphoma [153]
151 JWCAR029 Drug Info Phase 1 Non-hodgkin lymphoma [154]
152 MEDl-551 Drug Info Phase 1 Scleroderma [155]
153 Patient-derived CD19- and CD22 specific CAR Drug Info Phase 1 leukaemia [156]
154 PZ01 CAR-T cells Drug Info Phase 1 Acute lymphoblastic leukaemia [157]
155 Anti-CD19 Chimeric Antigen Receptor T Cells Drug Info Clinical trial leukaemia [158]
156 Anti-CD19/20-CAR vector-transduced T cells Drug Info Clinical trial Acute lymphoblastic leukaemia [159]
157 CAR-CD19 T cell Drug Info Clinical trial B-cell lymphoma [160]
158 CD19-CAR T Cells Drug Info Clinical trial Acute lymphoblastic leukaemia [161]
159 CD19-targeted CAR-T cells Drug Info Clinical trial leukaemia [162]
160 CD19-targeted CAR-T cells Drug Info Clinical trial leukaemia [163]
161 CD19-UCART Drug Info Clinical trial Acute lymphoblastic leukaemia [164]
162 CD19CART Drug Info Clinical trial B-cell lymphoma [165]
Preclinical Drug(s) [+] 3 Preclinical Drugs +
1 Anti-CD19 CAR T cells Drug Info Phase 0 Hodgkin lymphoma [166]
2 CART19 cells Drug Info Phase 0 Hodgkin lymphoma [167]
3 SGN-19A Drug Info Preclinical Haematological malignancy [168]
Mode of Action [+] 5 Modes of Action +
Immunostimulant [+] 2 Immunostimulant drugs +
1 Axicabtagene ciloleucel Drug Info [2]
2 Tisagenlecleucel Drug Info [2]
Modulator [+] 9 Modulator drugs +
1 Blinatumomab Drug Info [1]
2 CTL019 Drug Info [171]
3 JCAR015 Drug Info [172]
4 Xmab 5871 Drug Info [176], [177]
5 JCAR014 Drug Info [172]
6 JCAR017 Drug Info [172]
7 AFM-11 Drug Info [177]
8 Combotox Drug Info [188]
9 Anti-CD22/CD19 mab-toxin conjugate Drug Info [193]
CAR-T-Cell-Therapy [+] 116 CAR-T-Cell-Therapy drugs +
1 CART-19 Drug Info [5]
2 CD19 CAR T cells Drug Info [6], [169]
3 CAR-T cells targeting CD19 Drug Info [10]
4 CART 19 Drug Info [11], [12], [170]
5 CD19 CAR T cells Drug Info [15]
6 CTL019 Drug Info [18], [19]
7 JCAR015 Drug Info [21]
8 KYMRIAH Drug Info [23]
9 MB-CART19.1 Drug Info [24]
10 TBI-1501 Drug Info [87]
11 XLCART001 Drug Info [27]
12 YESCARTA Drug Info [23]
13 4SCAR19 cells Drug Info [30]
14 Anti-CD19 CAR T cells Drug Info [33], [34]
15 Anti-CD19 CAR transduced T cells Drug Info [35]
16 Anti-CD19 CAR-T Drug Info [36]
17 Anti-CD19 CAR-T cells Drug Info [37]
18 Anti-CD19 CAR-T cells Drug Info [38]
19 Anti-CD19 CAR-T cells Drug Info [39], [40]
20 Anti-CD19 CAR-T cells Drug Info [41]
21 Anti-CD19-CAR PBL Drug Info [42]
22 Anti-CD19-CAR vector-transduced T cells Drug Info [43], [44]
23 Anti-CD19-CAR-T cells Drug Info [45]
24 Autologous Anti-CD19CAR-4-1BB-CD3zeta-EGFRt-expressing T Lymphocytes Drug Info [49]
25 Autologous CD19-targeting CAR T cells Drug Info [50]
26 CAR-T cells targeting CD19 Drug Info [51]
27 CARCIK-CD19 Drug Info [52]
28 CART-19 cells Drug Info [53]
29 CD19 CAR Gene Transduced T Lymphocytes Drug Info [58]
30 CD19 CAR T Cells Drug Info [59]
31 CD19 CAR T cells Drug Info [60]
32 CD19 CAR-T Cells Drug Info [61]
33 CD19 CAR-T lymphocytes Drug Info [62]
34 CD19 CART Drug Info [63]
35 CD19 CART Drug Info [64]
36 CD19 specific CAR T cells Drug Info [65]
37 CD19 targeted chimeric antigen receptor T cells Drug Info [66]
38 CD19-CAR T cell Drug Info [67]
39 CD19-directed CAR-T cells Drug Info [68]
40 CD19-targeting CAR T cells Drug Info [16], [17]
41 CD19-targeting CAR T Cells Drug Info [69]
42 CD19.CAR T Cells Drug Info [71]
43 CD19.CAR-T cells Drug Info [72]
44 Chimeric Antigen Receptor Modified T cells Targeting CD19 Drug Info [73]
45 CLIC-1901 Drug Info [74]
46 Humanized CD19 CAR-T cells Drug Info [75]
47 IM19 CAR-T Drug Info [76], [77]
48 JCAR017 Drug Info [22], [179], [180]
49 PBCAR0191 Drug Info [83]
50 PCAR-019 (anti-CD19 CAR-T cells) Drug Info [84]
51 SCRI-huCAR19v1 Drug Info [85]
52 SJCAR19 Drug Info [86]
53 TriCAR-T-CD19 Drug Info [88]
54 UCART019 Drug Info [89]
55 19-28z T CELLS Drug Info [90]
56 4SCAR19 cells Drug Info [91]
57 Allogeneic CART-19 Drug Info [93]
58 Anti-CD19 CAR-T Drug Info [95]
59 Anti-CD19 CAR-T cells Drug Info [96]
60 Anti-CD19 CART Cells Drug Info [97]
61 Anti-CD19- CAR Drug Info [98]
62 Anti-CD19-CAR T Drug Info [99]
63 Anti-CD19-CAR T cells Drug Info [100]
64 AntiCD19 CART Drug Info [102]
65 ARI-0001 cells Drug Info [103]
66 C-CAR011 Drug Info [105], [106]
67 CAR-T cells targeting CD19 Drug Info [108]
68 CAR-T Cells targeting CD19 Drug Info [109]
69 CAR19 T cells carrying cytoplasmic activated PD-1 Drug Info [110]
70 CART-19 Drug Info [13], [182], [183], [184], [185]
71 CART-19 Drug Info [111]
72 CART-19 Drug Info [112]
73 CART-19 autologous T-cells Drug Info [113]
74 CART-19 cells Drug Info [186], [14]
75 CART-19 cells Drug Info [114]
76 CART-19 cells Drug Info [115]
77 CART-19 T cells Drug Info [116]
78 CART19 cell Drug Info [118]
79 CD19 CAR T Drug Info [121]
80 CD19 CAR T Cells Drug Info [122]
81 CD19 CAR T cells Drug Info [123], [187]
82 CD19 CAR T-cells Drug Info [124]
83 CD19 CAR T-cells Drug Info [125]
84 CD19 CAR-T cells Drug Info [126]
85 CD19 CAR-T cells Drug Info [127]
86 CD19 Redirected Autologous T Cells Drug Info [128]
87 CD19+ CAR T Cells Drug Info [129]
88 CD19-CAR-T Cells Drug Info [131]
89 CD19-CAR-T2 Cells Drug Info [132]
90 CD19-directed CAR-T cells Drug Info [133]
91 CD19-directed CAR-T cells Drug Info [134]
92 CD19-targeted CART cells Drug Info [135]
93 CD19-TriCAR-T Drug Info [136]
94 CD19.CAR-aNKT cells Drug Info [137]
95 CD19CAT-41BBZ CAR T-cells Drug Info [141]
96 EGFRt/19-28z/4-1BBL CAR T cells Drug Info [144]
97 HuCART19 Drug Info [145]
98 Human CD19 targeted T Cells Drug Info [146]
99 IC9-CAR19 cells Drug Info [147], [148]
100 IC9-CAR19 T cells Drug Info [149]
101 ICAR19 CAR-T cells Drug Info [150]
102 IM19 Drug Info [189], [151]
103 JCAR014 Drug Info [152]
104 JCAR017 Drug Info [80], [190], [81]
105 JWCAR029 Drug Info [153]
106 JWCAR029 Drug Info [154]
107 PZ01 CAR-T cells Drug Info [157]
108 Anti-CD19 Chimeric Antigen Receptor T Cells Drug Info [158]
109 CAR-CD19 T cell Drug Info [160]
110 CD19-CAR T Cells Drug Info [161]
111 CD19-targeted CAR-T cells Drug Info [191], [192], [162]
112 CD19-targeted CAR-T cells Drug Info [163]
113 CD19-UCART Drug Info [164]
114 CD19CART Drug Info [165]
115 Anti-CD19 CAR T cells Drug Info [166]
116 CART19 cells Drug Info [167]
Inhibitor [+] 3 Inhibitor drugs +
1 Coltuximab ravtansine Drug Info [9]
2 Inebilizumab Drug Info [20]
3 KTE-C19 CAR Drug Info [181]
CAR-T-Cell-Therapy(Dual specific) [+] 32 CAR-T-Cell-Therapy(Dual specific) drugs +
1 4SCAR19 and 4SCAR123 Drug Info [29]
2 4SCAR19 and 4SCAR20 Drug Info [29]
3 4SCAR19 and 4SCAR22 Drug Info [29]
4 4SCAR19 and 4SCAR30 Drug Info [29]
5 4SCAR19 and 4SCAR38 Drug Info [29]
6 4SCAR19 and 4SCAR70 Drug Info [29]
7 4SCAR19/22 T cells Drug Info [31]
8 Anti-CD19 and Anti-CD20 CAR-T Cells Drug Info [32]
9 Anti-CD19/22-CAR vector-transduced T cells Drug Info [46]
10 Anti-CD20 CAR-T cells Drug Info [47]
11 AUTO3 Drug Info [48], [178]
12 CART-19/22 Drug Info [54]
13 CART-19/BCMA Drug Info [55]
14 CD19 and CD20 CAR-T Cells Drug Info [56]
15 CD19 and CD22 CAR-T Cells Drug Info [57]
16 CD19 and CD22 CAR-T Cells Drug Info [56]
17 CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells Drug Info [70]
18 Anti-CD19 anti-CD20 Bispecific CAR-T Drug Info [94]
19 Anti-CD19/BCMA CAR-T cells Drug Info [101]
20 BCMA CART and huCART19 Drug Info [104]
21 CAR-20/19-T Cells Drug Info [107]
22 CART-meso-19 T cells Drug Info [117]
23 CART22-65s cells and huCART19 Cells Drug Info [119]
24 CARTmeso/19 Drug Info [120]
25 CD19-CAR and CD28-CAR T Cells Drug Info [130]
26 CD19/CD22 CAR T cells Drug Info [138]
27 CD19/CD22 CAR T-Cells Drug Info [139]
28 CD19/CD22 Chimeric Antigen Receptor T Cells Drug Info [140]
29 Donor-derived CD19/22 bispecific CAR-T cells Drug Info [134]
30 Dual Specificity CD19 and CD22 CAR-T Cell Drug Info [143]
31 Patient-derived CD19- and CD22 specific CAR Drug Info [156]
32 Anti-CD19/20-CAR vector-transduced T cells Drug Info [159]
Target Regulators
Target-regulating Transcription Factors
Target-regulating Transcription Factors Info 
Target-interacting Proteins
Target-interacting Proteins Info 
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Expression Profile Info 
Target Affiliated Biological Pathways
KEGG Pathway [+] 5 KEGG Pathways +
1 PI3K-Akt signaling pathway
2 Hematopoietic cell lineage
3 B cell receptor signaling pathway
4 Epstein-Barr virus infection
5 Primary immunodeficiency
NetPath Pathway [+] 1 NetPath Pathways +
1 IL-7 Signaling Pathway
Panther Pathway [+] 1 Panther Pathways +
1 B cell activation
PID Pathway [+] 1 PID Pathways +
1 BCR signaling pathway
Reactome [+] 4 Reactome Pathways +
1 PIP3 activates AKT signaling
2 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
3 Constitutive Signaling by Aberrant PI3K in Cancer
4 Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
WikiPathways [+] 5 WikiPathways +
1 Human Complement System
2 Signaling by the B Cell Receptor (BCR)
3 PIP3 activates AKT signaling
4 B Cell Receptor Signaling Pathway
5 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Target-Related Models and Studies
Target Validation
Target Validation Info 
References
REF 1 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
REF 2 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85.
REF 3 ClinicalTrials.gov (NCT02013167) Blinatumomab Versus Standard of Care Chemotherapy in Patients With Relapsed or Refractory Acute Lymphoblastic Leukemia (ALL)
REF 4 ClinicalTrials.gov (NCT02393859) Phase 3 Trial of Blinatumomab vs Standard Chemotherapy in Pediatric Subjects With HR First Relapse B-precursor ALL
REF 5 ClinicalTrials.gov (NCT03027739) CART-19 Cells For MRD Positive CD19+ ALL
REF 6 ClinicalTrials.gov (NCT03391739) CART-19 Cells For R/R B-ALL
REF 7 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 8 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 9 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 10 ClinicalTrials.gov (NCT03196830) CAR-T for R/R B-NHL
REF 11 ClinicalTrials.gov (NCT02935543) CART19 in Adult Patients With Minimal Residual Disease During Upfront Treatment for ALL
REF 12 ClinicalTrials.gov (NCT02906371) Study of the Tocilizumab Optimization Timing for CART19 Associated Cytokine Release Syndrome
REF 13 ClinicalTrials.gov (NCT02030834) Phase IIa Study of Redirected Autologous T Cells Engineered to Contain Anti-CD19 Attached to TCRz and 4-Signaling Domains in Patients With Chemotherapy Relapsed or Refractory CD19+ Lymphomas
REF 14 ClinicalTrials.gov (NCT02794246) CART-19 Post-ASCT for Multiple Myeloma
REF 15 ClinicalTrials.gov (NCT02846584) a Clinical Research of Sequential CAR-T Bridging HSCT in the Treatment of Relapse/Refractory B-cell Malignancies
REF 16 ClinicalTrials.gov (NCT02132624) CD19-targeting 3rd Generation CAR T Cells for Refractory B Cell Malignancy - a Phase I/IIa Trial.
REF 17 ClinicalTrials.gov (NCT03068416) CD19-targeting, 3rd Generation CAR T Cells for Refractory B Cells Malignancy
REF 18 ClinicalTrials.gov (NCT02445248) Study of Efficacy and Safety of CTL019 in Adult DLBCL Patients. U.S. National Institutes of Health.
REF 19 ClinicalTrials.gov (NCT03601442) CTL019 Out of Specification MAP for ALL or DLBCL Patients
REF 20 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 21 ClinicalTrials.gov (NCT02535364) Study Evaluating the Efficacy and Safety of JCAR015 in Adult B-cell Acute Lymphoblastic Leukemia (B-ALL).
REF 22 ClinicalTrials.gov (NCT03484702) Trial to Determine the Efficacy and Safety of JCAR017 in Adult Subjects With Aggressive B-Cell Non-Hodgkin Lymphoma
REF 23 ClinicalTrials.gov (NCT03642626) MT2017-45 :CAR-T Cell Therapy for Heme Malignancies
REF 24 ClinicalTrials.gov (NCT03321123) MB-CART19.1 in Patients With R/R ALL
REF 25 ClinicalTrials.gov (NCT01974479) Pilot Study of Redirected Haploidentical Natural Killer Cell Infusions for B-Lineage Acute Lymphoblastic Leukemia. U.S. National Institutes of Health.
REF 26 A dose-escalation study of SAR3419, an anti-CD19 antibody maytansinoid conjugate, administered by intravenous infusion once weekly in patients with relapsed/refractory B-cell non-Hodgkin lymphoma. Clin Cancer Res. 2014 Jan 1;20(1):213-20.
REF 27 ClinicalTrials.gov (NCT03598179) XLCART001 Treatment in Relapsed/Refractory/High-risk B-cell Malignancy Subjects
REF 28 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035125)
REF 29 ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
REF 30 ClinicalTrials.gov (NCT03050190) A Phase I/II Multiple Center Trial of 4SCAR19 Cells in the Treatment of Relapsed and Refractory B Cell Malignancies
REF 31 ClinicalTrials.gov (NCT03098355) Interleukin-2 Following 4SCAR19/22 T Cells Targeting Refractory and/or Recurrent B Cell Malignancies
REF 32 ClinicalTrials.gov (NCT03207178) Sequential Infusion of Anti-CD19 and Anti-CD20 CAR-T Cells Against Relapsed and Refractory B-cell Lymphoma
REF 33 ClinicalTrials.gov (NCT02842138) Autologous CD19 CAR T Cells in Relapsed or Refractory B-cell Lymphoma
REF 34 ClinicalTrials.gov (NCT02247609) Evaluation of 4th Generation Safety-designed CAR T Cells Targeting High-risk and Refractory B Cell Lymphomas
REF 35 ClinicalTrials.gov (NCT03191773) A Study of Anti-CD19 CAR-T Cell Immunotherapy for Refractory /Relapsed B Cell Malignancies
REF 36 ClinicalTrials.gov (NCT02685670) Competitive Transfer of CD19-TCRz-CD28 and CD19-TCRz-CD137 CAR-T Cells for B-cell Leukemia/Lymphoma
REF 37 ClinicalTrials.gov (NCT02851589) Study Evaluating the Efficacy and Safety of PCAR-019 in CD19 Positive Relapsed or Refractory Leukemia and Lymphoma
REF 38 ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
REF 39 ClinicalTrials.gov (NCT03366324) Anti-CD19 CAR-T Therapy Combine With HSCT to Treat MRD+ B-cell Malignancies
REF 40 ClinicalTrials.gov (NCT03366350) Anti-CD19 CAR-T Therapy Bridging to HSCT for CD19+ B-Cell Malignancies
REF 41 ClinicalTrials.gov (NCT02782351) Humanized CAR-T Therapy for Treatment of B Cell Malignancy
REF 42 ClinicalTrials.gov (NCT00924326) CAR T Cell Receptor Immunotherapy for Patients With B-cell Lymphoma
REF 43 ClinicalTrials.gov (NCT02081937) CART-19 Immunotherapy in Mantle Cell Lymphoma
REF 44 ClinicalTrials.gov (NCT01864889) Treatment of Relapsed and/or Chemotherapy Refractory B-cell Malignancy by CART19
REF 45 ClinicalTrials.gov (NCT02672501) A Study to Assess CD19-targeted Immunotherapy T Cells in Patients With Relapsed or Refractory CD19+ B Cell Leukemia
REF 46 ClinicalTrials.gov (NCT03185494) Treatment of Relapsed and/or Chemotherapy Refractory B-cell Malignancy by Tandem CAR T Cells Targeting CD19 and CD22
REF 47 ClinicalTrials.gov (NCT02737085) the Sequential Therapy of CD19-targeted and CD20-targeted CAR-T Cell Therapy for Diffuse Large B Cell Lymphoma(DLBCL)
REF 48 ClinicalTrials.gov (NCT03289455) CD19 /22 CAR T Cells (AUTO3) for the Treatment of B Cell ALL
REF 49 ClinicalTrials.gov (NCT01865617) Laboratory Treated T Cells in Treating Patients With Relapsed or Refractory Chronic Lymphocytic Leukemia, Non-Hodgkin Lymphoma, or Acute Lymphoblastic Leukemia
REF 50 ClinicalTrials.gov (NCT02963038) CAR T Cells for Refractory B Cell Malignancy
REF 51 ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 52 ClinicalTrials.gov (NCT03389035) Transposon-manipulated Allogeneic CARCIK-CD19 Cells in Pediatric and Adult Patients With r/r ALL Post HSCT
REF 53 ClinicalTrials.gov (NCT03544021) CART-19 FOR Relapsed/Refractory Acute Lymphoblastic Leukemia ALL
REF 54 ClinicalTrials.gov (NCT03614858) CD19/CD22-targeted Chimeric Antigen Receptor Engineered T Cell (CART) in B-Cell Acute Lymphoblastic Leukemia.
REF 55 ClinicalTrials.gov (NCT03455972) Study of T Cells Targeting CD19/BCMA (CART-19/BCMA) for High Risk Multiple Myeloma Followed With Auto-HSCT
REF 56 ClinicalTrials.gov (NCT03398967) A Feasibility and Safety Study of Universal Dual Specificity CD19 and CD20 or CD22 CAR-T Cell Immunotherapy for Relapsed or Refractory Leukemia and Lymphoma
REF 57 ClinicalTrials.gov (NCT03468153) Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Relapsed and Refractory Lymphoma
REF 58 ClinicalTrials.gov (NCT02134262) Gene Therapy for B-Cell Non-Hodgkin Lymphoma Using CD19 CAR Gene Transduced T Lymphocytes
REF 59 ClinicalTrials.gov (NCT01475058) CD19 CAR T Cells for B Cell Malignancies After Allogeneic Transplant
REF 60 ClinicalTrials.gov (NCT02772198) T-cells Expressing Anti-CD19 CAR in Pediatric and Young Adults With B-cell Malignancies
REF 61 ClinicalTrials.gov (NCT03263208) CD19 CAR-T Cells for Patients With Relapse and Refractory CD19+ B-ALL.
REF 62 ClinicalTrials.gov (NCT03467256) CD19 T-CAR for Treatment of Children and Young Adults With r/r B-ALL
REF 63 ClinicalTrials.gov (NCT03146533) CD19 CART Cells for Patients With Relapse and Refractory CD19+ B-cell Lymphoma.
REF 64 ClinicalTrials.gov (NCT03232619) CD19-CART Treatment for ALL
REF 65 ClinicalTrials.gov (NCT02028455) A Pediatric and Young Adult Trial of Genetically Modified T Cells Directed Against CD19 for Relapsed/Refractory CD19+ Leukemia
REF 66 ClinicalTrials.gov (NCT03118180) CD19 Targeted Chimeric Antigen Receptor T Cells for B Cell Lymphoma
REF 67 ClinicalTrials.gov (NCT03373071) Anti-CD19 CAR T Cells in Pediatric Patients Affected by Relapsed/Refractory CD19+ ALL and NHL
REF 68 ClinicalTrials.gov (NCT02537977) CD19-directed CAR T Cells Therapy in Relapsed/Refractory B Cell Malignancy
REF 69 ClinicalTrials.gov (NCT02547948) CD19-targeting CAR T Cells for B Cell Lymphoma
REF 70 ClinicalTrials.gov (NCT02903810) Combination Transfer of CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells for B-cell Hematologic Malignancy
REF 71 ClinicalTrials.gov (NCT03676504) Treatment of Patients With Relapsed or Refractory CD19+ Lymphoid Disease With T Cells Expressing a Third-generation CAR
REF 72 ClinicalTrials.gov (NCT02652910) Memory-enriched CAR-T Cells Immunotherapy for B Cell Lymphoma
REF 73 ClinicalTrials.gov (NCT02349698) A Clinical Research of CAR T Cells Targeting CD19 Positive Malignant B-cell Derived Leukemia and Lymphoma
REF 74 ClinicalTrials.gov (NCT03765177) CLIC-1901 for the Treatment of Patients With Relapsed/Refractory CD19 Positive Hematologic Malignancies
REF 75 ClinicalTrials.gov (NCT03275493) Humanized CD19 CAR-T Cells With CRS Suppression Technology for r/r CD19+ Acute Lymphoblastic Leukemia
REF 76 ClinicalTrials.gov (NCT03142646) Safety and Efficacy Evaluation of IM19 CAR-T Cells
REF 77 ClinicalTrials.gov (NCT03173417) Safety and Efficacy Evaluation of IM19 CAR-T Cells (IM19CAR-T)
REF 78 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041075)
REF 79 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041076)
REF 80 ClinicalTrials.gov (NCT03436771) Long-term Follow-up Study for Patients Previously Treated With a Juno CAR T-Cell Product
REF 81 ClinicalTrials.gov (NCT03331198) Study Evaluating Safety and Efficacy of JCAR017 in Subjects With Relapsed or Refractory Chronic Lymphocytic Leukemia (CLL) or Small Lymphocytic Lymphoma (SLL)
REF 82 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800039436)
REF 83 ClinicalTrials.gov (NCT03666000) Dose-escalation Study of Safety of PBCAR0191 in Patients With r/r NHL and r/r B-cell ALL
REF 84 ClinicalTrials.gov (NCT02819583) CAR-T Cell Immunotherapy in CD19 Positive Relapsed or Refractory Leukemia and Lymphoma
REF 85 ClinicalTrials.gov (NCT03684889) CD19-specific CAR T Cells With a Fully Human Binding Domain for CD19+ Leukemia or Lymphoma
REF 86 ClinicalTrials.gov (NCT03573700) Evaluation of CD19-Specific CAR Engineered Autologous T-Cells for Treatment of Relapsed/Refractory CD19+ Acute Lymphoblastic Leukemia
REF 87 ClinicalTrials.gov (NCT03155191) Study of TBI-1501 for Relapsed or Refractory Acute Lymphoblastic Leukemia
REF 88 ClinicalTrials.gov (NCT03497533) Treatment of Refractory/Relapsed Non-Hodgkin Lymphoma With TriCAR-T_CD19
REF 89 ClinicalTrials.gov (NCT03166878) A Study Evaluating UCART019 in Patients With Relapsed or Refractory CD19+ Leukemia and Lymphoma
REF 90 ClinicalTrials.gov (NCT01840566) High Dose Therapy and Autologous Stem Cell Transplantation Followed by Infusion of Chimeric Antigen Receptor (CAR) Modified T-Cells Directed Against CD19+ B-Cells for Relapsed and Refractory Aggressive B Cell Non-Hodgkin Lymphoma
REF 91 ClinicalTrials.gov (NCT02968472) A Phase I Trial of 4SCAR19 Cells in the Treatment of Relapsed and Refractory B Cell Leukemia
REF 92 ClinicalTrials.gov (NCT02106091) Safety Study to Assess AFM11 in Patients With Relapsed and/or Refractory CD19 Positive B-cell NHL or B-precursor ALL. U.S. National Institutes of Health.
REF 93 ClinicalTrials.gov (NCT02799550) Allogeneic CART-19 for Elderly Relapsed/Refractory CD19+ ALL
REF 94 ClinicalTrials.gov (NCT03271515) Immunotherapy With Bispecific CAR-T Cells for B-Cell Lymphoma, ALL and CLL
REF 95 ClinicalTrials.gov (NCT03110640) Anti-CD19 CAR T Infusion Combined With Allogeneic Stem Cell Transplantation for B-cell Leukemia/Lymphoma
REF 96 ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 97 ClinicalTrials.gov (NCT03767725) Anti-BCMA or/and Anti-CD19 CART Cells Treatment of Relapsed Multiple Myeloma
REF 98 ClinicalTrials.gov (NCT01593696) Anti-CD19 White Blood Cells for Children and Young Adults With B Cell Leukemia or Lymphoma
REF 99 ClinicalTrials.gov (NCT02546739) Immunotherapy With CD19 CAR T-cells for B-Cell Lymphoma, ALL and CLL
REF 100 ClinicalTrials.gov (NCT02659943) T Cells Expressing a Fully-human AntiCD19 Chimeric Antigen Receptor for Treating B-cell Malignancies
REF 101 ClinicalTrials.gov (NCT03706547) Anti-CD19/BCMA Bispecific CAR-T Cell Therapy for R/R MM
REF 102 ClinicalTrials.gov (NCT03434769) AntiCD19 Chimeric Antigen Receptor T Cells for Relapsed or Refractory Non Hodgkin Lymphoma
REF 103 ClinicalTrials.gov (NCT03144583) Pilot Study on the Infusion of ARI-0001 Cells in Patients With CD19+ Leukemia or Lymphoma Refractory to Therapy
REF 104 ClinicalTrials.gov (NCT03549442) Up-front CART-BCMA With or Without huCART19 in High-risk Multiple Myeloma
REF 105 ClinicalTrials.gov (NCT03299738) A Study Evaluating Safety and Efficacy of C-CAR011 in Subjects With B-NHL
REF 106 ClinicalTrials.gov (NCT03154775) Study of Safety and Efficacy of C-CAR011 in B-NHL Patients
REF 107 ClinicalTrials.gov (NCT03375619) Long-term Follow-up Study of Patients Receiving CAR-20/19-T Cells
REF 108 ClinicalTrials.gov (NCT03086954) Study Evaluating the Efficacy and Safety With CAR-T Immunotherapy for CD19 Positive Lymphoma
REF 109 ClinicalTrials.gov (NCT03186118) Pilot Study of T-APCs Following CAR T Cell Immunotherapy for CD19+ Leukemia
REF 110 ClinicalTrials.gov (NCT03540303) Cytoplasmic Activated PD-1 CAR T Cells in Refractory/Relapsed B Cell Lymphoma
REF 111 ClinicalTrials.gov (NCT03101709) The Safety and Efficacy of CART-19 Cells in Relapse and Refractory Patients With CD19+ B-cell Lymphoma
REF 112 ClinicalTrials.gov (NCT02810223) Efficacy of CART-19 Cell Therapy in B Cell Acute Lymphoblastic Leukemia
REF 113 ClinicalTrials.gov (NCT02476734) FDG-PET/CT Imaging as Early Predictor of DP
REF 114 ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
REF 115 ClinicalTrials.gov (NCT02924753) The Safety and Efficacy of CART-19 Cells in B-cell Acute Lymphoblastic Leukemia (B-ALL).
REF 116 ClinicalTrials.gov (NCT02135406) CART-19 for Multiple Myeloma
REF 117 ClinicalTrials.gov (NCT02465983) Pilot Study of Autologous T-cells in Patients With Metastatic Pancreatic Cancer
REF 118 ClinicalTrials.gov (NCT03685786) CART19 Cells Treatment of MRD of B Cell Malignancies and Then Auto-HSCT
REF 119 ClinicalTrials.gov (NCT03620058) CART22 Alone or in Combination With huCART19 for ALL
REF 120 ClinicalTrials.gov (NCT03497819) Autologous CARTmeso/19 Against Pancreatic Cancer
REF 121 ClinicalTrials.gov (NCT03559439) CD19-targeting CAR T Cells in Relapsed or Refractory CD19 Positive B-cell Malignancies
REF 122 ClinicalTrials.gov (NCT01853631) Activated T-Cells Expressing 2nd or 3rd Generation CD19-Specific CAR, Advanced B-Cell NHL, ALL, and CLL (SAGAN)
REF 123 ClinicalTrials.gov (NCT02975687) CD19 CAR T Cells in Patients With Resistant or Refractory CD19+ Acute Lymphoblastic Leukemia
REF 124 ClinicalTrials.gov (NCT03298828) CD19 CAR and PD-1 Knockout Engineered T Cells for CD19 Positive Malignant B-cell Derived Leukemia and Lymphoma
REF 125 ClinicalTrials.gov (NCT02443831) CARPALL: Immunotherapy With CD19 CAR T-cells for CD19+ Haematological Malignancies
REF 126 ClinicalTrials.gov (NCT03671460) CD19 CAR-T Cells for Patients With Relapse and Refractory CD19+ B-ALL.
REF 127 ClinicalTrials.gov (NCT03064269) CAR-T Therapy for Central Nervous System B-cell Acute Lymphocytic Leukemia
REF 128 ClinicalTrials.gov (NCT03030976) A Study of CD19 Redirected Autologous T Cells for CD19 Positive Systemic Lupus Erythematosus (SLE)
REF 129 ClinicalTrials.gov (NCT02529813) CD19+ CAR T Cells for Lymphoid Malignancies
REF 130 ClinicalTrials.gov (NCT02146924) Cellular Immunotherapy in Treating Patients With High-Risk Acute Lymphoblastic Leukemia
REF 131 ClinicalTrials.gov (NCT03574168) CD19-CAR-T Cells in Patients With R/R B-ALL
REF 132 ClinicalTrials.gov (NCT02822326) Phase I Study of CD19-CAR-T2 Cells for Patients With Chemotherapy Resistant or Refractory CD19+ Acute Leukemia
REF 133 ClinicalTrials.gov (NCT03483688) A Phaseb Study Evaluating Safety and Efficacy of C-CAR011 Treatment in B- NHL Subjects
REF 134 ClinicalTrials.gov (NCT03463928) A Feasibility and Safety Study of Concomitant Therapy With Allo-CAR-T Cells and Allo-HSCT in Patients With Relapse or Refractory Leukemia
REF 135 ClinicalTrials.gov (NCT03599375) Immunotherapy With CD19 CART-cells for B Cell Acute Lymphoblastic Leukemia
REF 136 ClinicalTrials.gov (NCT03720496) Treatment of Refractory/Relapsed Non-Hodgkin Lymphoma With CD19-TriCAR-T Cell Therapy
REF 137 ClinicalTrials.gov (NCT03774654) CD19.CAR Allogeneic NKT for Patients With Relapsed or Refractory B-Cell Malignancies (ANCHOR)
REF 138 ClinicalTrials.gov (NCT03241940) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Children or Young Adults With Recurrent or Refractory CD19 Positive B Acute Lymphoblastic Leukemia
REF 139 ClinicalTrials.gov (NCT03448393) CD19/CD22 Chimeric Antigen Receptor (CAR) T Cells in Children and Young Adults With Recurrent or Refractory CD19/CD22-expressing B Cell Malignancies
REF 140 ClinicalTrials.gov (NCT03233854) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Patients With Recurrent or Refractory CD19 Positive Diffuse Large B-Cell Lymphoma or B Acute Lymphoblastic Leukemia
REF 141 ClinicalTrials.gov (NCT02935257) Immunotherapy for High Risk/Relapsed CD19+ Acute Lymphoblastic Leukaemia Using CAR T-cells to Target CD19
REF 142 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936)
REF 143 ClinicalTrials.gov (NCT03593109) Safety and Efficacy Study of Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy in Relapsed or Refractory Lymphoma
REF 144 ClinicalTrials.gov (NCT03085173) A Trial of "Armored" CAR T Cells Targeting CD19 For Patients With Relapsed CD19+ Hematologic Malignancies
REF 145 ClinicalTrials.gov (NCT02374333) Pilot Study of Redirected Autologous T Cells Engineered to Contain Humanized Anti-CD19 in Patients With Relapsed or Refractory CD19+ Leukemia and Lymphoma Previously Treated With Cell Therapy
REF 146 ClinicalTrials.gov (NCT03720457) Human CD19 Targeted T Cells Injection(CD19 CAR-T) Therapy for Relapsed and Refractory CD19-positive Lymphoma.
REF 147 ClinicalTrials.gov (NCT03016377) Administration of Autologous CAR-T CD19 Antigen With Inducible Safety Switch in Patients With Relapsed/Refractory Acute Lymphoblastic Leukemia
REF 148 ClinicalTrials.gov (NCT03594162) Compassionate Use of CAR T Cells Targeting the CD19 Antigen and Containing the Inducible Caspase 9 Safety Switch
REF 149 ClinicalTrials.gov (NCT03696784) Anti-CD19 CAR-T Cells With Inducible Caspase 9 Safety Switch for B-cell Lymphoma
REF 150 ClinicalTrials.gov (NCT03383952) A Clinical Study of CD19 Targeted CAR-T for Patients With CD19+ Lymphoma and Leukemia
REF 151 ClinicalTrials.gov (NCT03344705) Safety and Efficacy Evaluation of IM19 Cells
REF 152 ClinicalTrials.gov (NCT02706405) JCAR014 and Durvalumab in Treating Patients With Relapsed or Refractory B-cell Non-Hodgkin Lymphoma
REF 153 ClinicalTrials.gov (NCT03344367) Study Evaluating the Safety and Efficacy of JWCAR029 in Adult Subjects With Relapsed and Refractory B-cell Non-Hodgkin Lymphoma
REF 154 ClinicalTrials.gov (NCT03355859) Study Evaluating the Safety and Efficacy of JWCAR029 in Adult Subjects With Relapsed and Refractory B-cell Non-Hodgkin Lymphoma
REF 155 CD19 as an attractive target for antibody-based therapy. MAbs. 2012 Sep-Oct;4(5):571-7.
REF 156 ClinicalTrials.gov (NCT03330691) A Feasibility and Safety Study of Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Leukemia and Lymphoma
REF 157 ClinicalTrials.gov (NCT03281551) Efficacy and Safety of PZ01 Treatment in Patients With r/r CD19+ B-cell Acute Lymphoblastic Leukemia/B Cell Lymphoma
REF 158 ClinicalTrials.gov (NCT03624686) Production of Clinical-grade Anti-CD19 Chimeric Antigen Receptor T Cells for Refractory B-cell Malignancies
REF 159 ClinicalTrials.gov (NCT03097770) Treatment of Relapsed and/or Chemotherapy Refractory B-cell Malignancy by Tandem CAR T Cells Targeting CD19 and CD20
REF 160 ClinicalTrials.gov (NCT03302403) Clinical Study of Redirected Autologous T Cells With a Chimeric Antigen Receptor in Patients With Malignant Tumors
REF 161 ClinicalTrials.gov (NCT03423706) Clinical Studies of New Model Haploidentical Hematopoietic Stem Cell Transplantation
REF 162 ClinicalTrials.gov (NCT02735291) Study Evaluating the Efficacy and Safety With CAR-T for Recurrent or Refractory Acute Non T Lymphocyte Leukemia
REF 163 ClinicalTrials.gov (NCT03564977) CD19-targeted CAR-T Cell Therapy for MRD+ B-cell Malignancies After Autologous Stem Cell Transplantation
REF 164 ClinicalTrials.gov (NCT03229876) Safety and Efficacy Evaluation of CD19-UCART
REF 165 ClinicalTrials.gov (NCT02813837) Chimeric Antigen Receptor T Cells (CART) Therapy in Refractory/Relapsed B Cell Hematologic Malignancies
REF 166 ClinicalTrials.gov (NCT02277522) CD19 Redirected Autologous T Cells for Hodgkin Lymphoma
REF 167 ClinicalTrials.gov (NCT02624258) Pilot Study of Non-Viral, RNA-Redirected Autologous T Cells in Patients With Refractory or Relapsed Hodgkin Lymphoma
REF 168 2011 Pipeline of Seattle Genetics.
REF 169 ClinicalTrials.gov (NCT03391726) CART-19 Cells for R/R B-cell Lymphoma
REF 170 ClinicalTrials.gov (NCT02640209) Pilot Trial Of Autologous T Cells Engineered To Express Anti-CD19 Chimeric Antigen Receptor (CART19)In Combination With Ibrutinib In Patients With Relapsed Or Refractory CD19+ Chronic Lymphocytic Leukemia (CLL)Or Small Lymphocytic Lymphoma (SLL)
REF 171 Clinical pipeline report, company report or official report of Novartis.
REF 172 Clinical pipeline report, company report or official report of JUNO Therapeutics.
REF 173 A nonfucosylated human antibody to CD19 with potent B-cell depletive activity for therapy of B-cell malignancies. Cancer Immunol Immunother. 2010 Feb;59(2):257-65.
REF 174 Clinical pipeline report, company report or official report of MedImmune (2011).
REF 175 A phase 1 trial of the Fc-engineered CD19 antibody XmAb5574 (MOR00208) demonstrates safety and preliminary efficacy in relapsed CLL. Blood. 2014 Dec 4;124(24):3553-60.
REF 176 Suppression of rheumatoid arthritis B cells by XmAb5871, an anti-CD19 antibody that coengages B cell antigen receptor complex and Fc receptor IIb inhibitory receptor.Arthritis Rheumatol.2014 May;66(5):1153-64.
REF 177 Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801.
REF 178 ClinicalTrials.gov (NCT03287817) CD19/22 CAR T Cells (AUTO3) for the Treatment of Diffuse Large B Cell Lymphoma
REF 179 ClinicalTrials.gov (NCT03310619) A Safety and Efficacy Trial of JCAR017 Combinations in Subjects With Relapsed/Refractory B-cell Malignancies (PLATFORM)
REF 180 ClinicalTrials.gov (NCT03743246) A Study to Evaluate the Safety and Efficacy of JCAR017 in Pediatric Subjects With Relapsed/Refractory (r/r) B-cell Acute Lymphoblastic Leukemia (B-ALL) and B-cell Non-Hodgkin Lymphoma (B-NHL)
REF 181 Clinical pipeline report, company report or official report of Kite Pharma.
REF 182 ClinicalTrials.gov (NCT01029366) CART19 to Treat B-Cell Leukemia or Lymphoma That Are Resistant or Refractory to Chemotherapy
REF 183 ClinicalTrials.gov (NCT01747486) CD19 Redirected Autologous T Cells
REF 184 ClinicalTrials.gov (NCT01626495) Phase I/IIA Study of CART19 Cells for Patients With Chemotherapy Resistant or Refractory CD19+ Leukemia and Lymphoma
REF 185 ClinicalTrials.gov (NCT02030847) Study of Redirected Autologous T Cells Engineered to Contain Anti-CD19 Attached to TCR and 4-1BB Signaling Domains in Patients With Chemotherapy Resistant or Refractory Acute Lymphoblastic Leukemia
REF 186 ClinicalTrials.gov (NCT01551043) Allo CART-19 Protocol
REF 187 ClinicalTrials.gov (NCT03029338) CD19 CAR T Cells in Patients With Relapsed or Refractory CD19 Positive B-cell Lymphoma
REF 188 A phase I study of a combination of anti-CD19 and anti-CD22 immunotoxins (Combotox) in adult patients with refractory B-lineage acute lymphoblastic leukaemia.Br J Haematol.2011 Aug;154(4):471-6.
REF 189 ClinicalTrials.gov (NCT03528421) Assessment of Safety and Efficacy of IM19 for Relapsed or Refractory NHL Patients
REF 190 ClinicalTrials.gov (NCT02631044) Study Evaluating the Safety and Pharmacokinetics of JCAR017 in B-cell Non-Hodgkin Lymphoma (TRANSCEND-NHL-001)
REF 191 ClinicalTrials.gov (NCT02728882) Study Evaluating the Efficacy and Safety With CAR-T for Recurrent or Refractory Diffuse Large B Cell Lymphoma
REF 192 ClinicalTrials.gov (NCT03488160) CAR-T Treatment for Relapse / Refractory Type Safety and Effectiveness of Lymphoma
REF 193 Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.