Target General Infomation
Target ID
T66693 (Former ID: TTDR00934)
Target Name
B-cell maturation protein (TNFRSF17)
Synonyms
Tumor necrosis factor receptor superfamily member 17; CD269; BCMA; BCM
Gene Name
TNFRSF17
Target Type
Clinical trial target
[1]
Disease [+] 7 Target-related Diseases +
1 Leukaemia [ICD-11: 2A60-2B33]
2 Lymphoma [ICD-11: 2A80-2A86]
3 Multiple myeloma [ICD-11: 2A83]
4 Follicular lymphoma [ICD-11: 2A80]
5 Malignant haematopoietic neoplasm [ICD-11: 2B33]
6 Mature B-cell leukaemia [ICD-11: 2A82]
7 Mature B-cell lymphoma [ICD-11: 2A85]
Function
Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL.
UniProt ID
TNR17_HUMAN
Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE
YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS
ISAR
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 41 Clinical Trial Drugs +
1 Bb2121 Drug Info Phase 2 Multiple myeloma [2], [3], [4]
2 Bb2121 Drug Info Phase 2 Multiple myeloma [5], [6]
3 LCAR-B38M CAR-T Cell Drug Info Phase 2 Multiple myeloma [1], [7]
4 Anti-BCMA CAR-T cells Drug Info Phase 1/2 Multiple myeloma [8]
5 Anti-BCMA-CAR-transduced T cells Drug Info Phase 1/2 leukaemia [9]
6 AUTO2 Drug Info Phase 1/2 Multiple myeloma [10]
7 BCMA CAR T cells Drug Info Phase 1/2 Multiple myeloma [11]
8 BCMA CAR-T Drug Info Phase 1/2 Multiple myeloma [12]
9 CAR-T cells targeting BCMA Drug Info Phase 1/2 leukaemia [13]
10 CART-19/BCMA Drug Info Phase 1/2 Multiple myeloma [14]
11 CART-BCMA cells Drug Info Phase 1/2 Multiple myeloma [15]
12 CD38 and BCMA CAR-T Cells Drug Info Phase 1/2 Multiple myeloma [16]
13 JCARH125 Drug Info Phase 1/2 Multiple myeloma [17], [18]
14 JNJ-68284528 Drug Info Phase 1/2 Multiple myeloma [19]
15 AMG 420 Drug Info Phase 1 Multiple myeloma [5], [6]
16 Anti-BCMA CAR T cells Drug Info Phase 1 Multiple myeloma [20], [21]
17 Anti-BCMA CAR T cells Drug Info Phase 1 Multiple myeloma [22]
18 Anti-BCMA CAR-T cells Drug Info Phase 1 Multiple myeloma [23]
19 Anti-BCMA CAR-T cells Drug Info Phase 1 leukaemia [24]
20 Anti-BCMA CART Cells Drug Info Phase 1 Multiple myeloma [25]
21 Anti-CD19/BCMA CAR-T cells Drug Info Phase 1 Multiple myeloma [26]
22 Autologous Anti-BCMA-CAR-expressing CD4+/CD8+ T-lymphocytes FCARH143 Drug Info Phase 1 Plasma cell myeloma [27]
23 Bb21217 Drug Info Phase 1 Multiple myeloma [28]
24 BCMA CAR-T Cells Drug Info Phase 1 Multiple myeloma [29]
25 BCMA CART Drug Info Phase 1 Multiple myeloma [30]
26 BCMA CART and huCART19 Drug Info Phase 1 Multiple myeloma [30]
27 BCMA nanobody CAR-T cells Drug Info Phase 1 Multiple myeloma [31]
28 BCMA-specific CAR-expressing T Lymphocytes Drug Info Phase 1 Plasma cell myeloma [32]
29 C-CAR088 Drug Info Phase 1 Multiple myeloma [33]
30 CAR-T cells targeting BCMA Drug Info Phase 1 Multiple myeloma [34]
31 CART-BCMA Drug Info Phase 1 Multiple myeloma [35]
32 Descartes-08 Drug Info Phase 1 Multiple myeloma [36]
33 IM21 CART Drug Info Phase 1 Multiple myeloma [37]
34 KITE-585 Drug Info Phase 1 Multiple myeloma [38]
35 LCAR-B4822M CAR-T Cell Drug Info Phase 1 Multiple myeloma [39]
36 P-BCMA-101 Drug Info Phase 1 Multiple myeloma [40]
37 P-BCMA-101 CAR-T cells Drug Info Phase 1 Multiple myeloma [41]
38 BCMA-CART Drug Info Clinical trial Multiple myeloma [42]
39 BCMA-UCART Drug Info Clinical trial Multiple myeloma [43]
40 CAR-BCMA T cell Drug Info Clinical trial Multiple myeloma [44]
41 CAR-T cells targeting BCMA Drug Info Clinical trial Multiple myeloma [45]
Mode of Action [+] 4 Modes of Action +
CAR-T-Cell-Therapy [+] 34 CAR-T-Cell-Therapy drugs +
1 LCAR-B38M CAR-T Cell Drug Info [1], [7]
2 Anti-BCMA CAR-T cells Drug Info [8]
3 Anti-BCMA-CAR-transduced T cells Drug Info [9]
4 BCMA CAR T cells Drug Info [11]
5 BCMA CAR-T Drug Info [12]
6 CAR-T cells targeting BCMA Drug Info [13]
7 CART-BCMA cells Drug Info [15]
8 JCARH125 Drug Info [17], [18]
9 JNJ-68284528 Drug Info [19]
10 Anti-BCMA CAR T cells Drug Info [20], [21]
11 Anti-BCMA CAR T cells Drug Info [22]
12 Anti-BCMA CAR-T cells Drug Info [23]
13 Anti-BCMA CAR-T cells Drug Info [24]
14 Anti-BCMA CART Cells Drug Info [25]
15 Autologous Anti-BCMA-CAR-expressing CD4+/CD8+ T-lymphocytes FCARH143 Drug Info [27]
16 Bb2121 Drug Info [2], [3], [4]
17 Bb21217 Drug Info [28]
18 BCMA CAR-T Cells Drug Info [29]
19 BCMA CART Drug Info [30]
20 BCMA nanobody CAR-T cells Drug Info [31]
21 BCMA-specific CAR-expressing T Lymphocytes Drug Info [32]
22 C-CAR088 Drug Info [33]
23 CAR-T cells targeting BCMA Drug Info [34]
24 CART-BCMA Drug Info [35]
25 Descartes-08 Drug Info [36]
26 IM21 CART Drug Info [37]
27 KITE-585 Drug Info [38]
28 LCAR-B4822M CAR-T Cell Drug Info [39]
29 P-BCMA-101 Drug Info [40]
30 P-BCMA-101 CAR-T cells Drug Info [41]
31 BCMA-CART Drug Info [42]
32 BCMA-UCART Drug Info [43]
33 CAR-BCMA T cell Drug Info [44]
34 CAR-T cells targeting BCMA Drug Info [45]
CAR-T-Cell-Therapy(Dual specific) [+] 5 CAR-T-Cell-Therapy(Dual specific) drugs +
1 AUTO2 Drug Info [10]
2 CART-19/BCMA Drug Info [14]
3 CD38 and BCMA CAR-T Cells Drug Info [16]
4 Anti-CD19/BCMA CAR-T cells Drug Info [26]
5 BCMA CART and huCART19 Drug Info [30]
Stimulator [+] 1 Stimulator drugs +
1 AMG 420 Drug Info [6]
Immunomodulator [+] 1 Immunomodulator drugs +
1 Bb2121 Drug Info [6]
Target Regulators
Target-interacting Proteins
References
REF 1 ClinicalTrials.gov (NCT03758417) A Study of LCAR-B38M CAR-T Cells, a Chimeric Antigen Receptor T-cell (CAR-T) Therapy Directed Against B-cell Maturation Antigen (BCMA) in Chinese Participants With Relapsed or Refractory Multiple Myeloma
REF 2 ClinicalTrials.gov (NCT02658929) Study of bb2121 in Multiple Myeloma
REF 3 ClinicalTrials.gov (NCT03361748) Efficacy and Safety Study of bb2121 in Subjects With Relapsed and Refractory Multiple Myeloma (KarMMa)
REF 4 ClinicalTrials.gov (NCT03601078) An Efficacy and Safety Study of bb2121 in Subjects With Relapsed and Refractory Multiple Myeloma and in Subjects With High-Risk Multiple Myeloma Having Progressed Within One Year of Initial Treatment
REF 5 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 6 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 7 ClinicalTrials.gov (NCT03090659) LCAR-B38M-02 Cells in Treating Relapsed/Refractory (R/R) Multiple Myeloma
REF 8 ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
REF 9 ClinicalTrials.gov (NCT02954445) A Clinical Research of BCMA-Targeted CAR-T in B Cell Malignancies
REF 10 ClinicalTrials.gov (NCT03287804) APRIL CAR T Cells (AUTO2) Targeting BCMA and TACI for the Treatment of Multiple Myeloma
REF 11 ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma
REF 12 ClinicalTrials.gov (NCT03322735) Study of BCMA CAR-T in Multiple Myeloma
REF 13 ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 14 ClinicalTrials.gov (NCT03455972) Study of T Cells Targeting CD19/BCMA (CART-19/BCMA) for High Risk Multiple Myeloma Followed With Auto-HSCT
REF 15 ClinicalTrials.gov (NCT03196414) Study of CART-138/BCMA Therapy for R/R Multiple Myeloma
REF 16 ClinicalTrials.gov (NCT03767751) A Feasibility and Safety Study of Dual Specificity CD38 and BCMA CAR-T Cell Immunotherapy for Relapsed or Refractory Multiple Myeloma
REF 17 ClinicalTrials.gov (NCT03436771) Long-term Follow-up Study for Patients Previously Treated With a Juno CAR T-Cell Product
REF 18 ClinicalTrials.gov (NCT03430011) Study Evaluating the Safety and Efficacy of JCARH125 in Subjects With Relapsed and/or Refractory Multiple Myeloma
REF 19 ClinicalTrials.gov (NCT03548207) A Study of JNJ-68284528, a Chimeric Antigen Receptor T Cell (CAR-T) Therapy Directed Against B-Cell Maturation Antigen (BCMA) in Participants With Relapsed or Refractory Multiple Myeloma
REF 20 ClinicalTrials.gov (NCT02215967) Study of T Cells Targeting B-Cell Maturation Antigen for Previously Treated Multiple Myeloma
REF 21 ClinicalTrials.gov (NCT03602612) T Cells Expressing a Novel Fully-Human Anti-BCMA CAR for Treating Multiple Myeloma
REF 22 ClinicalTrials.gov (NCT03559764) Study of BCMA CAR-T in Multiple Myeloma
REF 23 ClinicalTrials.gov (NCT03093168) BCMA Chimeric Antigen Receptor Expressing T Cells in Multiple Myeloma
REF 24 ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 25 ClinicalTrials.gov (NCT03767725) Anti-BCMA or/and Anti-CD19 CART Cells Treatment of Relapsed Multiple Myeloma
REF 26 ClinicalTrials.gov (NCT03706547) Anti-CD19/BCMA Bispecific CAR-T Cell Therapy for R/R MM
REF 27 ClinicalTrials.gov (NCT03338972) Immunotherapy With BCMA CAR-T Cells in Treating Patients With BCMA Positive Relapsed or Refractory Multiple Myeloma
REF 28 ClinicalTrials.gov (NCT03274219) Study of bb21217 in Multiple Myeloma
REF 29 ClinicalTrials.gov (NCT03661554) BCMA Nano Antibody CAR-T Cells for Patients With Refractory and Relapsed Multiple Myeloma
REF 30 ClinicalTrials.gov (NCT03549442) Up-front CART-BCMA With or Without huCART19 in High-risk Multiple Myeloma
REF 31 ClinicalTrials.gov (NCT03664661) BCMA-CAR-T in Relapsed/Refractory Multiple Myeloma
REF 32 ClinicalTrials.gov (NCT03502577) BCMA-Specific CAR T-Cells Combined With a Gamma Secretase Inhibitor (LY3039478) to Treat Relapsed or Persistent Multiple Myeloma
REF 33 ClinicalTrials.gov (NCT03751293) A Study of BCMA-directed CAR-T Cells Treatment in Subjects With r/r Multiple Myeloma
REF 34 ClinicalTrials.gov (NCT03672253) CAR-T Re-treatment for Refractory/Relapsed Multiple Myeloma
REF 35 ClinicalTrials.gov (NCT02546167) CART-BCMA Cells for Multiple Myeloma
REF 36 ClinicalTrials.gov (NCT03448978) Autologous CD8+ T-cells Expressing an Anti-BCMA CAR in Patients With Myeloma
REF 37 ClinicalTrials.gov (NCT03711864) Safety and Efficacy of IM21 Car-t Cells in Patients With Recurrent or Refractory BCMA Positive Multiple Myeloma
REF 38 ClinicalTrials.gov (NCT03318861) A Study Evaluating the Safety and Efficacy of KITE-585 in Subjects With Relapsed/Refractory Multiple Myeloma
REF 39 ClinicalTrials.gov (NCT03674463) LCAR-B4822M-02 Cells in Treating Relapsed/Refractory (R/R) Multiple Myeloma
REF 40 ClinicalTrials.gov (NCT03741127) Long-Term Follow-Up Study for Subjects Treated With P-BCMA-101
REF 41 ClinicalTrials.gov (NCT03288493) P-BCMA-101 Tscm CAR-T Cells in the Treatment of Patients With Multiple Myeloma (MM)
REF 42 ClinicalTrials.gov (NCT03492268) Safety and Efficacy Evaluation of BCMA-CART for Treating Multiple Myeloma
REF 43 ClinicalTrials.gov (NCT03752541) Efficacy and Safety Evaluation of BCMA-UCART
REF 44 ClinicalTrials.gov (NCT03302403) Clinical Study of Redirected Autologous T Cells With a Chimeric Antigen Receptor in Patients With Malignant Tumors
REF 45 ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.