Target General Infomation
Target ID
T71377 (Former ID: TTDR00012)
Target Name
Interleukin 3 receptor alpha (IL3RA)
Synonyms
Interleukin-3 receptor subunit alpha; IL3R; IL-3RA; IL-3R-alpha; IL-3R subunit alpha; IL-3 receptor subunit alpha; CD123 antigen; CD123
Gene Name
IL3RA
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Acute myeloid leukaemia [ICD-11: 2A60]
Function
This is a receptor for interleukin-3.
BioChemical Class
Cytokine receptor
UniProt ID
IL3RA_HUMAN
Sequence
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
KAGLEECLVTEVQVVQKT
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Tagraxofusp Drug Info Approved Blastic plasmacytoid dendritic cell neoplasm [1]
Clinical Trial Drug(s) [+] 17 Clinical Trial Drugs +
1 CD123/CLL1 CAR-T Cells Drug Info Phase 2/3 Acute myeloid leukaemia [2]
2 Talacotuzumab Drug Info Phase 2 Acute myeloid leukaemia [3], [4]
3 4SCAR19 and 4SCAR123 Drug Info Phase 1/2 B-cell lymphoma [5]
4 Anti-CD123-CAR-transduced T cells Drug Info Phase 1/2 leukaemia [6]
5 CART-123 cells Drug Info Phase 1/2 Acute myeloid leukaemia [7]
6 CD123-specific gene-engineered T cells Drug Info Phase 1/2 Acute myeloid leukaemia [8]
7 Anti-CD123 CAR-T cells Drug Info Phase 1 leukaemia [9]
8 CART-123 cells Drug Info Phase 1 Myelodysplastic syndrome [10]
9 CART123 cells Drug Info Phase 1 Acute myeloid leukaemia [11]
10 CD123CAR-41BB-CD3zeta-EGFRt-expressing T cells Drug Info Phase 1 Acute myeloid leukaemia [12]
11 CSL-362-AML Drug Info Phase 1 leukaemia [13]
12 Flotetuzumab Drug Info Phase 1 Acute myeloid leukaemia [3], [14]
13 IM23 Drug Info Phase 1 Acute myeloid leukaemia [15]
14 JNJ-63709178 Drug Info Phase 1 Acute myeloid leukaemia [3], [14]
15 MB-102 Drug Info Phase 1 Acute myeloid leukaemia [3], [14]
16 MGD006 Drug Info Phase 1 Acute myeloid lymphoma [16], [17]
17 UCART123 Drug Info Phase 1 Blastic plasmacytoid dendritic cell neoplasm [18]
Preclinical Drug(s) [+] 2 Preclinical Drugs +
1 Autologous Anti-CD 123 CAR TCR/4-1BB-expressing T-lymphocytes Drug Info Phase 0 Acute myeloid leukaemia [19]
2 CAR-T cells targeting CD123 Drug Info Preclinical Acute myeloid leukaemia [20]
Discontinued Drug(s) [+] 1 Discontinued Drugs +
1 Daniplestim Drug Info Terminated Osteoporosis [21]
Mode of Action [+] 4 Modes of Action +
Modulator [+] 3 Modulator drugs +
1 Tagraxofusp Drug Info [1]
2 JNJ-63709178 Drug Info [3]
3 MGD006 Drug Info [16], [24]
CAR-T-Cell-Therapy(Dual specific) [+] 2 CAR-T-Cell-Therapy(Dual specific) drugs +
1 CD123/CLL1 CAR-T Cells Drug Info [2]
2 4SCAR19 and 4SCAR123 Drug Info [5]
CAR-T-Cell-Therapy [+] 13 CAR-T-Cell-Therapy drugs +
1 Anti-CD123-CAR-transduced T cells Drug Info [6]
2 CART-123 cells Drug Info [7]
3 CD123-specific gene-engineered T cells Drug Info [8]
4 Anti-CD123 CAR-T cells Drug Info [9]
5 Anti-CD123 CAR-T treatment Drug Info [22]
6 CART-123 cells Drug Info [10]
7 CART123 cells Drug Info [11]
8 CD123CAR-41BB-CD3zeta-EGFRt-expressing T cells Drug Info [12]
9 IM23 Drug Info [15]
10 MB-102 Drug Info [3]
11 UCART123 Drug Info [18], [25]
12 Autologous Anti-CD 123 CAR TCR/4-1BB-expressing T-lymphocytes Drug Info [19]
13 CAR-T cells targeting CD123 Drug Info [20]
Agonist [+] 1 Agonist drugs +
1 Daniplestim Drug Info [26]
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 5 KEGG Pathways +
1 Cytokine-cytokine receptor interaction
2 PI3K-Akt signaling pathway
3 Apoptosis
4 Jak-STAT signaling pathway
5 Hematopoietic cell lineage
NetPath Pathway [+] 2 NetPath Pathways +
1 IL5 Signaling Pathway
2 IL3 Signaling Pathway
PID Pathway [+] 1 PID Pathways +
1 IL3-mediated signaling events
Reactome [+] 5 Reactome Pathways +
1 GPVI-mediated activation cascade
2 G beta:gamma signalling through PI3Kgamma
3 Interleukin-3, 5 and GM-CSF signaling
4 RAF/MAP kinase cascade
5 Interleukin receptor SHC signaling
WikiPathways [+] 3 WikiPathways +
1 IL-3 Signaling Pathway
2 Interleukin-2 signaling
3 Interleukin-3, 5 and GM-CSF signaling
References
REF 1 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89.
REF 2 ClinicalTrials.gov (NCT03631576) CD123/CLL1 CAR-T Cells for R/R AML
REF 3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 4 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 5 ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
REF 6 ClinicalTrials.gov (NCT02937103) A Clinical Research of CD123-Targeted CAR-T in Myeloid Malignancies
REF 7 ClinicalTrials.gov (NCT03556982) CART-123 FOR Relapsed/Refractory Acute Myelocytic LeukemiaAML
REF 8 ClinicalTrials.gov (NCT03222674) Multi-CAR T Cell Therapy for Acute Myeloid Leukemia
REF 9 ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 10 ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
REF 11 ClinicalTrials.gov (NCT03766126) Lentivirally Redirected CD123 Autologous T Cells in AML
REF 12 ClinicalTrials.gov (NCT03114670) Donor-derived Anti-CD123-CART Cells for Recurred AML After Allo-HSCT
REF 13 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031973)
REF 14 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 15 ClinicalTrials.gov (NCT03585517) Safety and Efficacy Evaluation of IM23 CAR-T Cells (IM23CAR-T)
REF 16 A Phase I trial of MGD006 in patients with relapsed acute myeloid leukemia (AML). J Immunother Cancer. 2014; 2(Suppl 3): P87.
REF 17 ClinicalTrials.gov (NCT02152956) Safety Study of MGD006 in Relapsed/Refractory Acute Myeloid Leukemia (AML) or Intermediate-2/High Risk MDS
REF 18 ClinicalTrials.gov (NCT03203369) Study to Evaluate the Safety and Clinical Activity of UCART123 in Patients With BPDCN
REF 19 ClinicalTrials.gov (NCT02623582) CD123 Redirected Autologous T Cells for AML
REF 20 ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia
REF 21 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005988)
REF 22 ClinicalTrials.gov (NCT03672851) Study Evaluating Safety and Efficacy of CAR-T Cells Targeting CD123 in Patients With Acute Leukemia
REF 23 Monoclonal antibody targeting of IL-3 receptor alpha with CSL362 effectively depletes CML progenitor and stem cells. Blood. 2014 Feb 20;123(8):1218-28.
REF 24 A CD3xCD123 bispecific DART for redirecting host T cells to myelogenous leukemia: preclinical activity and safety in nonhuman primates.Sci Transl Med.2015 May 27;7(289):289ra82.
REF 25 ClinicalTrials.gov (NCT03190278) Study Evaluating Safety and Efficacy of UCART123 in Patients With Acute Myeloid Leukemia
REF 26 The combined administration of daniplestim and Mpl ligand augments the hematopoietic reconstitution observed with single cytokine administration in a nonhuman primate model of myelosuppression. Stem Cells. 1998;16 Suppl 2:143-54.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.