Target General Infomation
Target ID
T74937 (Former ID: TTDI02054)
Target Name
Dopamine beta hydroxylase (DBH)
Synonyms
Soluble dopamine betahydroxylase; Dopamine betamonooxygenase; Dopamine betahydroxylase; Dopamine beta-monooxygenase; Dopamine beta-hydroxylase
Gene Name
DBH
Target Type
Clinical trial target
[1]
Disease [+] 2 Target-related Diseases +
1 Heart failure [ICD-11: BD10-BD1Z]
2 Post-traumatic stress disorder [ICD-11: 6B40]
Function
Conversion of dopamine to noradrenaline.
BioChemical Class
Paired donor oxygen oxidoreductase
UniProt ID
DOPO_HUMAN
EC Number
EC 1.14.17.1
Sequence
MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GRSPAGPTVVSIGGGKG
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 2 Clinical Trial Drugs +
1 Etamicastat Drug Info Phase 2 Heart failure [2]
2 Nepicastat oral Drug Info Phase 2 Post-traumatic stress disorder [3], [4]
Mode of Action [+] 1 Modes of Action +
Inhibitor [+] 2 Inhibitor drugs +
1 Etamicastat Drug Info [1]
2 Nepicastat oral Drug Info [5]
Target Regulators
Target-regulating Transcription Factors
Target-interacting Proteins
Target Affiliated Biological Pathways
BioCyc [+] 1 BioCyc Pathways +
1 Catecholamine biosynthesis
KEGG Pathway [+] 2 KEGG Pathways +
1 Tyrosine metabolism
2 Metabolic pathways
Panther Pathway [+] 2 Panther Pathways +
1 Adrenaline and noradrenaline biosynthesis
2 Dopamine receptor mediated signaling pathway
Pathwhiz Pathway [+] 2 Pathwhiz Pathways +
1 Catecholamine Biosynthesis
2 Tyrosine Metabolism
WikiPathways [+] 3 WikiPathways +
1 Monoamine Transport
2 Biogenic Amine Synthesis
3 Metabolism of amino acids and derivatives
References
REF 1 Safety, tolerability, and pharmacokinetics of etamicastat, a novel dopamine-beta-hydroxylase inhibitor, in a rising multiple-dose study in young healthy subjects. Drugs R D. 2010;10(4):225-42.
REF 2 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034724)
REF 3 ClinicalTrials.gov (NCT00641511) Pharmacogenetic Clinical Trial of Nepicastat for Post Traumatic Stress Disorder (PTSD). U.S. National Institutes of Health.
REF 4 ClinicalTrials.gov (NCT01704196) A Multi-Center Trial of Nepicastat for Cocaine Dependence. U.S. National Institutes of Health.
REF 5 Catecholamine modulatory effects of nepicastat (RS-25560-197), a novel, potent and selective inhibitor of dopamine-beta-hydroxylase. Br J Pharmacol. 1997 Aug;121(8):1803-9.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.