Target Information

Target General Infomation
Target ID
T77664 (Former ID: TTDC00096)
Target Name
Interferon-gamma (IFNG)
Synonyms
Interferon gamma; Immune interferon; IFN-gamma
Gene Name
IFNG
Target Type
Successful target
 [1]
Disease [+] 1 Target-related Diseases +
1 Adaptive immunity immunodeficiency [ICD-11: 4A01]
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
BioChemical Class
Cytokine: interferon
UniProt ID
IFNG_HUMAN
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Emapalumab Drug Info Approved Primary haemophagocytic lymphohistiocytosis [1]
Clinical Trial Drug(s) [+] 4 Clinical Trial Drugs +
1 Fumaric acid Drug Info Phase 3 Multiple sclerosis [2]
2 VIR-201 Drug Info Phase 1/2 Human immunodeficiency virus infection [3]
3 AMG 811 Drug Info Phase 1 Systemic lupus erythematosus [4]
4 CIGB-128 Drug Info Phase 1 Basal cell carcinoma [5]
Discontinued Drug(s) [+] 4 Discontinued Drugs +
1 CRx-191 Drug Info Discontinued in Phase 2 Psoriatic disorder [6]
2 Fontolizumab Drug Info Discontinued in Phase 2 Rheumatoid arthritis [7]
3 TAK-603 Drug Info Discontinued in Phase 2 Inflammatory bowel disease [8]
4 TG-1042 Drug Info Discontinued in Phase 2 B-cell lymphoma [9]
Preclinical Drug(s) [+] 1 Preclinical Drugs +
1 VPM-4-001 Drug Info Preclinical Prostate cancer [10]
Mode of Action [+] 3 Modes of Action +
Modulator [+] 6 Modulator drugs +
1 Emapalumab Drug Info [1]
2 VIR-201 Drug Info [11]
3 AMG 811 Drug Info [12]
4 CIGB-128 Drug Info [13]
5 TAK-603 Drug Info [16]
6 TG-1042 Drug Info [17]
Binder [+] 1 Binder drugs +
1 Fumaric acid Drug Info [2]
Inhibitor [+] 1 Inhibitor drugs +
1 CRx-191 Drug Info [14]
Target Regulators
Target-regulating microRNAs
Target-regulating microRNAs Info 
Target-regulating Transcription Factors
Target-regulating Transcription Factors Info 
Target-interacting Proteins
Target-interacting Proteins Info 
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Expression Profile Info 
Target Affiliated Biological Pathways
KEGG Pathway [+] 28 KEGG Pathways +
1 Proteasome
2 Cytokine-cytokine receptor interaction
3 HIF-1 signaling pathway
4 Regulation of autophagy
5 TGF-beta signaling pathway
6 Osteoclast differentiation
7 Antigen processing and presentation
8 Jak-STAT signaling pathway
9 Natural killer cell mediated cytotoxicity
10 T cell receptor signaling pathway
11 Type I diabetes mellitus
12 Salmonella infection
13 Leishmaniasis
14 Chagas disease (American trypanosomiasis)
15 African trypanosomiasis
16 Malaria
17 Toxoplasmosis
18 Amoebiasis
19 Tuberculosis
20 Measles
21 Influenza A
22 Herpes simplex infection
23 Epstein-Barr virus infection
24 Inflammatory bowel disease (IBD)
25 Systemic lupus erythematosus
26 Rheumatoid arthritis
27 Allograft rejection
28 Graft-versus-host disease
NetPath Pathway [+] 4 NetPath Pathways +
1 IL1 Signaling Pathway
2 TCR Signaling Pathway
3 IL2 Signaling Pathway
4 Leptin Signaling Pathway
Panther Pathway [+] 2 Panther Pathways +
1 Inflammation mediated by chemokine and cytokine signaling pathway
2 Interferon-gamma signaling pathway
PID Pathway [+] 16 PID Pathways +
1 IL27-mediated signaling events
2 IL12-mediated signaling events
3 Calcineurin-regulated NFAT-dependent transcription in lymphocytes
4 SHP2 signaling
5 Regulation of Telomerase
6 Glucocorticoid receptor regulatory network
7 IL2-mediated signaling events
8 IFN-gamma pathway
9 ATF-2 transcription factor network
10 AP-1 transcription factor network
11 IL23-mediated signaling events
12 PDGFR-alpha signaling pathway
13 Calcium signaling in the CD4+ TCR pathway
14 Downstream signaling in na&#xef
15
16 IL12 signaling mediated by STAT4
Reactome [+] 2 Reactome Pathways +
1 Interferon gamma signaling
2 Regulation of IFNG signaling
WikiPathways [+] 16 WikiPathways +
1 Type II interferon signaling (IFNG)
2 Senescence and Autophagy in Cancer
3 TGF Beta Signaling Pathway
4 Cytokines and Inflammatory Response
5 Hypertrophy Model
6 Inflammatory Response Pathway
7 Aryl Hydrocarbon Receptor Pathway
8 IL1 and megakaryotyces in obesity
9 Hair Follicle Development: Cytodifferentiation (Part 3 of 3)
10 Spinal Cord Injury
11 Allograft Rejection
12 Interferon gamma signaling
13 Proteasome Degradation
14 Folate Metabolism
15 Vitamin B12 Metabolism
16 Selenium Micronutrient Network
Target-Related Models and Studies
Target Validation
Target Validation Info 
References
REF 1 2018 FDA drug approvals.Nat Rev Drug Discov. 2019 Feb;18(2):85-89.
REF 2 Emerging oral drugs for multiple sclerosis. Expert Opin Emerg Drugs. 2008 Sep;13(3):465-77.
REF 3 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010310)
REF 4 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028077)
REF 5 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037683)
REF 6 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025635)
REF 7 Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
REF 8 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006011)
REF 9 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010265)
REF 10 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023655)
REF 11 EP patent application no. 17782511, Nucleoside phosphonate conjugates as anti hiv agents.
REF 12 Pharmacokinetic and pharmacodynamic relationship of AMG 811, an anti-IFN-gamma IgG1 monoclonal antibody, in patients with systemic lupus erythematosus. Pharm Res. 2015 Feb;32(2):640-53.
REF 13 Pharmacokinetic and pharmacodynamic characterization of a new formulation containing synergistic proportions of interferons alpha-2b and gamma (HeberPAG) in patients with mycosis fungoides: an open-label trial.BMC Pharmacol Toxicol.2012 Dec 28;13:20.
REF 14 CombinatoRx Drug Candidate CRx-191 Demonstrates Positive Phase 2 Results In Psoriasis. CombinatoRx. 2008.
REF 15 Emerging drugs to treat Crohn's disease. Expert Opin Emerg Drugs. 2007 Mar;12(1):49-59.
REF 16 T helper 1 inhibitor TAK-603 inhibits IFN-gamma and IL-12 production with no effect on IL-18: an observation in sarcoidosis patients. Sarcoidosis Vasc Diffuse Lung Dis. 2004 Oct;21(3):204-11.
REF 17 Drug evaluation: TG-1042, an adenovirus-mediated IFNgamma gene delivery for the intratumoral therapy of primary cutaneous lymphomas. Curr Opin Investig Drugs. 2007 Jun;8(6):493-8.
REF 18 BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.