Target General Infomation
Target ID
T78709 (Former ID: TTDS00098)
Target Name
5-HT 1A receptor (HTR1A)
Synonyms
Serotonin receptor 1A; G-21; ADRBRL1; ADRB2RL1; 5-hydroxytryptamine receptor 1A; 5-HT1A receptor; 5-HT1A; 5-HT-1A
Gene Name
HTR1A
Target Type
Successful target
[1]
Disease [+] 5 Target-related Diseases +
1 Anxiety disorder [ICD-11: 6B00-6B0Z]
2 Depression [ICD-11: 6A70-6A7Z]
3 Hypertension [ICD-11: BA00-BA04]
4 Migraine [ICD-11: 8A80]
5 Mood disorder [ICD-11: 6A60-6E23]
Function
Functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli. G-protein coupled receptor for 5-hydroxytryptamine (serotonin).
BioChemical Class
GPCR rhodopsin
UniProt ID
5HT1A_HUMAN
Sequence
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Drugs and Modes of Action
Approved Drug(s) [+] 8 Approved Drugs +
1 Buspirone Drug Info Approved Anxiety disorder [2], [3]
2 Flibanserin Drug Info Approved Mood disorder [4], [5]
3 OPC-34712 Drug Info Approved Major depressive disorder [6], [7]
4 TERTATOLOL Drug Info Approved Hypertension [8], [9]
5 Trazodone Drug Info Approved Depression [10], [11]
6 Treximet Drug Info Approved Migraine [12]
7 Urapidil Drug Info Approved Hypertension [9]
8 Vilazodone Drug Info Approved Major depressive disorder [13], [14]
Clinical Trial Drug(s) [+] 31 Clinical Trial Drugs +
1 CM-2395 Drug Info Phase 3 Schizophrenia [15]
2 Eltoprazine Drug Info Phase 3 Attention deficit hyperactivity disorder [16]
3 Xaliproden Drug Info Phase 3 Juvenile idiopathic arthritis [17]
4 LECOZOTAN HYDROCHLORIDE Drug Info Phase 2/3 Cognitive impairment [18]
5 Sarizotan Drug Info Phase 2/3 Rett syndrome [19]
6 Ensaculin hydrochloride Drug Info Phase 2 Parkinson disease [20]
7 FKW00GA Drug Info Phase 2 Social phobia [16]
8 Mazapertine succinate Drug Info Phase 2 Psychotic disorder [21]
9 MIN-117 Drug Info Phase 2 Major depressive disorder [22]
10 MN-305 Drug Info Phase 2 Mood disorder [23]
11 Neu-P11 Drug Info Phase 2 Insomnia [24]
12 OPC-14523 Drug Info Phase 2 Mood disorder [25]
13 ORG-13011 Drug Info Phase 2 Psychotic disorder [26]
14 RP5063 Drug Info Phase 2 Schizophrenia [27]
15 S-15535 Drug Info Phase 2 Anxiety disorder [28], [29]
16 S-16924 Drug Info Phase 2 Anxiety disorder [30], [31], [32]
17 SDZ-MAR-327 Drug Info Phase 2 Psychotic disorder [33], [34]
18 SEP-363856 Drug Info Phase 2 Parkinson disease [19], [16]
19 SUN N4057 Drug Info Phase 2 Coronary artery disease [35]
20 TGBA01AD Drug Info Phase 2 Mood disorder [23]
21 TGFK08AA-ER Drug Info Phase 2 Generalized anxiety disorder [36]
22 TGFK09SD-ER Drug Info Phase 2 Hypoactive sexual desire dysfunction [37]
23 TGWOOAA Drug Info Phase 2 Social phobia [38]
24 Zalospirone Drug Info Phase 2 Anxiety disorder [39], [40]
25 1192U90 Drug Info Phase 1 Psychotic disorder [41]
26 AV-965 Drug Info Phase 1 Alzheimer disease [42]
27 DSP-1053 Drug Info Phase 1 Major depressive disorder [43]
28 GSK-958108 Drug Info Phase 1 Premature ejaculation [44]
29 NLX-101 Drug Info Phase 1 Rett syndrome [45]
30 SSR-181507 Drug Info Phase 1 Schizophrenia [33]
31 Umespirone Drug Info Phase 1 Anxiety disorder [46]
Patented Agent(s) [+] 5 Patented Agents +
1 PMID30124346-Compound-13TABLE4 Drug Info Patented Attention deficit hyperactivity disorder [47]
2 PMID30124346-Compound-34TABLE4 Drug Info Patented Attention deficit hyperactivity disorder [47]
3 PMID30124346-Compound-60TABLE5 Drug Info Patented Parkinson disease [47], [48], [49]
4 PMID30124346-Compound-LDT66 Drug Info Patented Benign prostatic hyperplasia [47]
5 PMID30124346-Compound-LDT8 Drug Info Patented Benign prostatic hyperplasia [47]
Discontinued Drug(s) [+] 36 Discontinued Drugs +
1 LYSERGIC ACID DIETHYLAMIDE Drug Info Withdrawn from market Addictive disorder [50], [51]
2 Bifeprunox Drug Info Discontinued in Phase 3 Schizophrenia [33]
3 BMS-181100 Drug Info Discontinued in Phase 3 Psychotic disorder [52], [53]
4 Flesinoxan Drug Info Discontinued in Phase 3 Anxiety disorder [54], [55]
5 Adatanserin Drug Info Discontinued in Phase 2 Mood disorder [23]
6 ALNESPIRONE Drug Info Discontinued in Phase 2 Anxiety disorder [56]
7 AP-521 Drug Info Discontinued in Phase 2 Anxiety disorder [57]
8 DU 125530 Drug Info Discontinued in Phase 2 Mood disorder [58]
9 GSK163090 Drug Info Discontinued in Phase 2 Anxiety disorder [59]
10 LESOPITRON DIHYDROCHLORIDE Drug Info Discontinued in Phase 2 Mood disorder [60]
11 PRX-00023 Drug Info Discontinued in Phase 2 Mood disorder [23]
12 REC-15/3079 Drug Info Discontinued in Phase 2 Urinary incontinence [61], [62]
13 Robalzotan Drug Info Discontinued in Phase 2 Anxiety disorder [63], [64]
14 BINOSPIRONE MESYLATE Drug Info Discontinued in Phase 1 Anxiety disorder [65]
15 DU-29894 Drug Info Discontinued in Phase 1 Psychotic disorder [66]
16 E2101 Drug Info Discontinued in Phase 1 Spasm [67]
17 Ebalzotan Drug Info Discontinued in Phase 1 Anxiety disorder [68]
18 Eptapirone Drug Info Discontinued in Phase 1 Anxiety disorder [69]
19 GR-127607 Drug Info Discontinued in Phase 1 Migraine [70]
20 Nerisopam Drug Info Discontinued in Phase 1 Anxiety disorder [71]
21 SLV-313 Drug Info Discontinued in Phase 1 Schizophrenia [33]
22 SUN-8399 Drug Info Discontinued in Phase 1 Anxiety disorder [72]
23 U-93385 Drug Info Discontinued in Phase 1 Anxiety disorder [73]
24 A-74283 Drug Info Terminated Hypertension [75]
25 Anpirtoline Drug Info Terminated Pain [76]
26 BTS-79018 Drug Info Terminated Schizophrenia [33]
27 CGS-18102A Drug Info Terminated Anxiety disorder [77]
28 Du-123015 Drug Info Terminated Anxiety disorder [78]
29 Gepirone ER Drug Info Terminated Depression [23]
30 HT-90B Drug Info Terminated Anxiety disorder [79]
31 Ipsapirone Drug Info Terminated Anxiety disorder [80], [81]
32 LY-293284 Drug Info Terminated Anxiety disorder [82], [83]
33 RWJ-25730 Drug Info Terminated Psychotic disorder [84]
34 S-14506 Drug Info Terminated Anxiety disorder [85], [86]
35 SLV-307 Drug Info Terminated Parkinson disease [87]
36 WAY-100635 Drug Info Terminated Eating disorder [88], [89]
Preclinical Drug(s) [+] 2 Preclinical Drugs +
1 CM-2236 Drug Info Preclinical Post-traumatic stress disorder [74]
2 PD-158771 Drug Info Preclinical Schizophrenia [33]
Mode of Action [+] 7 Modes of Action +
Agonist [+] 51 Agonist drugs +
1 Buspirone Drug Info [1]
2 Urapidil Drug Info [95]
3 CM-2395 Drug Info [96]
4 Eltoprazine Drug Info [100]
5 MN-305 Drug Info [23]
6 Neu-P11 Drug Info [103]
7 SEP-363856 Drug Info [19]
8 SUN N4057 Drug Info [111]
9 Zalospirone Drug Info [40]
10 1192U90 Drug Info [33]
11 Aryl piperazine derivative 14 Drug Info [47]
12 Aryl piperazine derivative 15 Drug Info [47]
13 Aryl piperazine derivative 16 Drug Info [47]
14 PMID30124346-Compound-13TABLE4 Drug Info [47]
15 Flesinoxan Drug Info [126]
16 Adatanserin Drug Info [23], [129]
17 ALNESPIRONE Drug Info [130], [9]
18 AP-521 Drug Info [131], [9]
19 LESOPITRON DIHYDROCHLORIDE Drug Info [133]
20 Ebalzotan Drug Info [141]
21 Eptapirone Drug Info [142]
22 GR-127607 Drug Info [143]
23 Nerisopam Drug Info [144]
24 SUN-8399 Drug Info [146]
25 U-93385 Drug Info [147], [9]
26 CM-2236 Drug Info [148]
27 A-74283 Drug Info [149]
28 Gepirone ER Drug Info [23]
29 Ipsapirone Drug Info [156]
30 LY-293284 Drug Info [157]
31 1-naphthylpiperazine Drug Info [181], [170]
32 5-CT Drug Info [196]
33 7-methoxy-1-naphthylpiperazine Drug Info [181]
34 BRL-15572 Drug Info [200]
35 CP 93129 Drug Info [196]
36 Dual norepinephrine reuptake inhibitors/5-HT1A partial agonists Drug Info [203]
37 EDMT Drug Info [204]
38 FG-5893 Drug Info [208]
39 L-772,405 Drug Info [210]
40 LP-12 Drug Info [211]
41 LP-211 Drug Info [212]
42 LP-44 Drug Info [211]
43 LY 165,163 Drug Info [208]
44 nafadotride Drug Info [208]
45 piribedil Drug Info [219]
46 S-14671 Drug Info [109]
47 SB 216641 Drug Info [200]
48 spiroxatrine Drug Info [208]
49 U92016A Drug Info [229]
50 [3H]8-OH-DPAT Drug Info [234]
51 [3H]NLX-112 Drug Info [235]
Modulator [+] 34 Modulator drugs +
1 Flibanserin Drug Info [5]
2 OPC-34712 Drug Info [90], [91]
3 Trazodone Drug Info [93]
4 Vilazodone Drug Info [14]
5 Sarizotan Drug Info [99]
6 Ensaculin hydrochloride Drug Info [20], [101]
7 FKB01MD Drug Info [16]
8 Mazapertine succinate Drug Info [99]
9 OPC-14523 Drug Info [104]
10 S-16924 Drug Info [31], [32]
11 SDZ-MAR-327 Drug Info [110]
12 TGBA01AD Drug Info [112]
13 TGFK08AA-ER Drug Info [113]
14 TGFK09SD-ER Drug Info [114]
15 NLX-101 Drug Info [119]
16 SSR-181507 Drug Info [120]
17 Bifeprunox Drug Info [123]
18 BMS-181100 Drug Info [124], [125]
19 PRX-00023 Drug Info [135]
20 DU-29894 Drug Info [139]
21 E2101 Drug Info [140]
22 SLV-313 Drug Info [145]
23 Anpirtoline Drug Info [76]
24 CGS-18102A Drug Info [152]
25 Du-123015 Drug Info [154]
26 HT-90B Drug Info [155]
27 RWJ-25730 Drug Info [159]
28 S-14506 Drug Info [160]
29 CGS-19480A Drug Info [201], [9]
30 EMD 56551 Drug Info [205]
31 NPT-500 Drug Info [203]
32 SEL-73 Drug Info [203]
33 SKL-PSY Drug Info [203]
34 SR-59026 Drug Info [228]
Inhibitor [+] 142 Inhibitor drugs +
1 TERTATOLOL Drug Info [92]
2 LYSERGIC ACID DIETHYLAMIDE Drug Info [122]
3 Sunepitron Drug Info [127]
4 TIOSPIRONE Drug Info [128]
5 MAZAPERTINE Drug Info [134]
6 A-80426 Drug Info [150]
7 BMY-7378 Drug Info [151]
8 CP-293019 Drug Info [153]
9 WB-4101 Drug Info [165]
10 (3-Chloro-phenyl)-piperazin-1-yl-methanone Drug Info [166]
11 (R)-(-)-10-methyl-11-hydroxyaporphine Drug Info [167]
12 (R)-11-Amino-2-methoxyaporphine Drug Info [168]
13 (R)-2,11-Diaminoaporphine Drug Info [168]
14 1,2,3,4-Tetrahydro-naphthalen-2-ylamine Drug Info [170]
15 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane Drug Info [171]
16 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane Drug Info [171]
17 1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane Drug Info [171]
18 1,6-bis(4-m-tolylpiperazin-1-yl)hexane Drug Info [171]
19 1,6-bis(4-phenylpiperazin-1-yl)hexane Drug Info [171]
20 1-((S)-2-aminopropyl)-1H-indazol-6-ol Drug Info [172]
21 1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine Drug Info [166]
22 1-(2,5-Dimethoxy-phenyl)-piperazine Drug Info [166]
23 1-(2,5-dimethoxyphenyl)propan-2-amine Drug Info [173]
24 1-(2-((3-fluorophenoxy)methyl)phenyl)piperazine Drug Info [174]
25 1-(2-(2-chlorophenoxy)pyridin-3-yl)piperazine Drug Info [175]
26 1-(2-(2-fluorobenzyloxy)phenyl)piperazine Drug Info [174]
27 1-(2-(3-fluorophenoxy)phenyl)piperazine Drug Info [174]
28 1-(2-(4-fluorophenoxy)phenyl)piperazine Drug Info [174]
29 1-(2-(benzyloxy)phenyl)piperazine Drug Info [174]
30 1-(2-(phenoxymethyl)phenyl)piperazine Drug Info [174]
31 1-(2-Butoxy-phenyl)-piperazine Drug Info [176]
32 1-(2-Chloro-phenyl)-piperazine Drug Info [177]
33 1-(2-Ethoxy-phenyl)-piperazine Drug Info [176]
34 1-(2-Fluoro-phenyl)-piperazine Drug Info [176]
35 1-(2-Isopropoxy-phenyl)-piperazine Drug Info [176]
36 1-(2-Methoxy-phenyl)-4-propyl-piperazine Drug Info [178]
37 1-(2-Methoxy-phenyl)-piperazine Drug Info [177]
38 1-(2-methoxyphenyl)-4-pentylpiperazine Drug Info [179]
39 1-(2-phenoxyphenyl)piperazine Drug Info [174]
40 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine Drug Info [180]
41 1-(3-Fluoro-phenyl)-piperazine Drug Info [176]
42 1-(3-Nitro-phenyl)-piperazine Drug Info [176]
43 1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine Drug Info [166]
44 1-(7-Methoxy-naphthalen-2-yl)-piperazine Drug Info [181]
45 1-(benzyloxy)-2-(2-phenylethyl)benzene Drug Info [182]
46 1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene Drug Info [182]
47 1-Benzyl-4-chroman-2-ylmethyl-piperazine Drug Info [183]
48 1-Butyl-4-(2-methoxy-phenyl)-piperazine Drug Info [178]
49 1-Ethyl-4-(2-methoxy-phenyl)-piperazine Drug Info [178]
50 1-Methyl-1,3-dihydro-indol-2-one Drug Info [184]
51 1-Naphthalen-2-yl-piperazine Drug Info [170]
52 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine Drug Info [185]
53 1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene Drug Info [182]
54 2-(2'-methyl-biphenyl-3-yl)-ethylamine Drug Info [186]
55 2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol Drug Info [173]
56 2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine Drug Info [175]
57 2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine Drug Info [175]
58 2-(2-Methoxy-phenyl)-1-methyl-ethylamine Drug Info [173]
59 2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine Drug Info [175]
60 2-(3-Bromophenylthio)-N,N-dimethylethanamine Drug Info [187]
61 2-(3-Methoxy-phenyl)-1-methyl-ethylamine Drug Info [173]
62 2-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one Drug Info [183]
63 2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine Drug Info [173]
64 2-(4-Bromo-phenyl)-1-methyl-ethylamine Drug Info [173]
65 2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine Drug Info [188]
66 2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine Drug Info [189]
67 2-(Biphenyl-3-ylthio)-N,N-dimethylethanamine Drug Info [187]
68 2-Dipropylamino-1,2,3,4-tetrahydro-anthracen-9-ol Drug Info [92]
69 2-phenoxy-3-(piperidin-4-yl)pyridine Drug Info [175]
70 2-Piperazin-1-yl-benzonitrile Drug Info [176]
71 2-Piperazin-1-yl-phenol Drug Info [166]
72 2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine Drug Info [182]
73 3-(1,2,3,6-Tetrahydro-pyridin-4-yl)-1H-indole Drug Info [190]
74 3-(1-Propyl-pyrrolidin-3-yl)-phenol Drug Info [185]
75 3-(2-Amino-propyl)-1H-indol-5-ol Drug Info [189]
76 3-(2-Benzylamino-ethoxy)-phenol Drug Info [191]
77 3-(3-Methanesulfonyl-phenyl)-1-propyl-pyrrolidine Drug Info [185]
78 3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one Drug Info [183]
79 3-(4-Benzyl-piperidin-1-ylmethyl)-chromen-4-one Drug Info [183]
80 3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine Drug Info [175]
81 3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one Drug Info [166]
82 3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol Drug Info [192]
83 3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol Drug Info [192]
84 3-Naphthalen-1-yl-1-propyl-pyrrolidine Drug Info [185]
85 3-Naphthalen-1-yl-pyrrolidine Drug Info [185]
86 3-Phenyl-1-propyl-pyrrolidine Drug Info [185]
87 3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine Drug Info [182]
88 4-(1H-indol-4-yloxy)-1-(isopropylamino)butan-2-ol Drug Info [193]
89 4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine Drug Info [174]
90 4-(2-(2-fluorobenzyloxy)phenyl)piperidine Drug Info [174]
91 4-(2-(3-chlorophenoxy)phenyl)piperidine Drug Info [174]
92 4-(2-(3-fluorophenoxy)phenyl)piperidine Drug Info [174]
93 4-(2-(4-fluorobenzyloxy)phenyl)piperidine Drug Info [174]
94 4-(2-(4-fluorophenoxy)phenyl)piperidine Drug Info [174]
95 4-(2-(benzyloxy)-3-fluorophenyl)piperidine Drug Info [174]
96 4-(2-(benzyloxy)-6-fluorophenyl)piperidine Drug Info [174]
97 4-(2-(benzyloxy)phenyl)piperidine Drug Info [174]
98 4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine Drug Info [175]
99 4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine Drug Info [174]
100 4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine Drug Info [174]
101 4-(2-fluoro-6-phenoxyphenyl)piperidine Drug Info [174]
102 4-(2-phenoxyphenyl)piperidine Drug Info [174]
103 4-(3-fluoro-2-phenoxyphenyl)piperidine Drug Info [174]
104 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [194]
105 4-Benzyl-1-chroman-2-ylmethyl-piperidine Drug Info [183]
106 4-Benzyl-1-chroman-3-ylmethyl-piperidine Drug Info [183]
107 5,6-dichloro-3,4-dihydroquinazolin-2-amine Drug Info [195]
108 5-chloro-3,4-dihydroquinazolin-2-amine Drug Info [195]
109 5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine Drug Info [195]
110 5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine Drug Info [195]
111 8-Methoxy-1,2,3,4-tetrahydro-naphthalen-2-ylamine Drug Info [92]
112 8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline Drug Info [170]
113 8-Methoxy-2-piperazin-1-yl-quinoline Drug Info [170]
114 8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine Drug Info [195]
115 8-Methoxy-quinolin-2-ylamine Drug Info [170]
116 9-Methoxy-1,2,3,4-tetrahydro-anthracen-2-ylamine Drug Info [92]
117 A-987306 Drug Info [198]
118 AGROCLAVINE Drug Info [199]
119 Brolamfetamine Drug Info [173]
120 CHLOROPHENYLPIPERAZINE Drug Info [176]
121 ESCHOLTZINE Drug Info [206]
122 Etisulergine Drug Info [207]
123 JNJ-10392980 Drug Info [209]
124 MCL-516 Drug Info [168]
125 N-(3-(1H-indol-4-yloxy)propyl)cyclohexanamine Drug Info [193]
126 N-(3-(1H-indol-4-yloxy)propyl)cyclopentanamine Drug Info [193]
127 N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide Drug Info [212]
128 N-methyllaurotetanine Drug Info [206]
129 N-[4-(4-Phenyl-piperazin-1-yl)-butyl]-benzamide Drug Info [214]
130 PB-28 Drug Info [217]
131 PG-01037 Drug Info [218]
132 PHENYLPIPERAZINE Drug Info [170]
133 QUIPAZINE Drug Info [220]
134 SB-271046 Drug Info [225]
135 SB-656104 Drug Info [226]
136 SEROTONIN Drug Info [220]
137 SNAP-8719 Drug Info [227]
138 TFMPP Drug Info [166]
139 UH-232 Drug Info [230]
140 UH-301 Drug Info [231]
141 WAY-466 Drug Info [232]
142 [3H]spiperone Drug Info [165]
Antagonist [+] 43 Antagonist drugs +
1 Treximet Drug Info [94]
2 Xaliproden Drug Info [97]
3 LECOZOTAN HYDROCHLORIDE Drug Info [9], [98]
4 FKW00GA Drug Info [16]
5 MIN-117 Drug Info [102]
6 ORG-13011 Drug Info [9], [105]
7 RP5063 Drug Info [106], [107]
8 S-15535 Drug Info [9], [108], [109]
9 TGWOOAA Drug Info [115]
10 AV-965 Drug Info [116]
11 DSP-1053 Drug Info [117]
12 GSK-958108 Drug Info [118]
13 Umespirone Drug Info [121]
14 PMID30124346-Compound-LDT8 Drug Info [47]
15 DU 125530 Drug Info [132]
16 GSK163090 Drug Info [94]
17 REC-15/3079 Drug Info [136]
18 Robalzotan Drug Info [137]
19 BINOSPIRONE MESYLATE Drug Info [138], [9]
20 PD-158771 Drug Info [33]
21 NAN-190 Drug Info [158]
22 SDZ 216-525 Drug Info [158]
23 SLV-307 Drug Info [161]
24 WAY 100135 Drug Info [158]
25 WAY-100635 Drug Info [132], [162], [163], [164]
26 (R)-flurocarazolol Drug Info [169]
27 (S)-flurocarazolol Drug Info [169]
28 (S)-UH-301 Drug Info [158]
29 (S)-WAY 100135 Drug Info [158]
30 9-OH-risperidone Drug Info [197]
31 cyamemazine Drug Info [202]
32 GR 125,743 Drug Info [196]
33 LY433221 Drug Info [213]
34 MPDT Drug Info [204]
35 P-MPPI Drug Info [215], [158]
36 p-[18F]MPPF Drug Info [216]
37 repinotan Drug Info [221]
38 SB 272183 Drug Info [223]
39 SB 649915 Drug Info [224]
40 SB 714786 Drug Info [224]
41 [11C]WAY100635 Drug Info [233]
42 [3H]p-MPPF Drug Info [236]
43 [3H]robalzotan Drug Info [237]
Ligand [+] 4 Ligand drugs +
1 Aryl piperazine derivative 1 Drug Info [47]
2 Aryl piperazine derivative 6 Drug Info [47]
3 PMID30124346-Compound-34TABLE4 Drug Info [47]
4 PMID30124346-Compound-60TABLE5 Drug Info [47]
Binder [+] 1 Binder drugs +
1 BTS-79018 Drug Info [33]
Modulator (allosteric modulator) [+] 1 Modulator (allosteric modulator) drugs +
1 RS-30199 Drug Info [222]
Target Regulators
Target-regulating Transcription Factors
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 3 KEGG Pathways +
1 cAMP signaling pathway
2 Neuroactive ligand-receptor interaction
3 Serotonergic synapse
Panther Pathway [+] 2 Panther Pathways +
1 Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway
2 5HT1 type receptor mediated signaling pathway
Reactome [+] 2 Reactome Pathways +
1 Serotonin receptors
2 G alpha (i) signalling events
WikiPathways [+] 6 WikiPathways +
1 Serotonin HTR1 Group and FOS Pathway
2 SIDS Susceptibility Pathways
3 Monoamine GPCRs
4 GPCRs, Class A Rhodopsin-like
5 GPCR ligand binding
6 GPCR downstream signaling
Target-Related Models and Studies
Target Validation
Target QSAR Model
References
REF 1 Interactions between corticotropin-releasing hormone and serotonin: implications for the aetiology and treatment of anxiety disorders. Handb Exp Pharmacol. 2005;(169):181-204.
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 36).
REF 3 Glutamate and anxiety disorders. Curr Psychiatry Rep. 2007 Aug;9(4):278-83.
REF 4 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8182).
REF 5 Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651.
REF 6 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672).
REF 7 ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health.
REF 8 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 64).
REF 9 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
REF 10 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 213).
REF 11 Emerging treatments for depression. Expert Opin Pharmacother. 2006 Dec;7(17):2323-39.
REF 12 FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021926.
REF 13 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7427).
REF 14 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
REF 15 Pharmaceutical Research Companies Are Developing More Than 300 Medicines to Treat Mental Illnesses. Pharmaceutical Research and Manufacturers of America report.2010.
REF 16 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 17 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 18 ClinicalTrials.gov (NCT00277810) Study Evaluating the Safety, Tolerability, and Efficacy of Lecozotan SR in Outpatients With Alzheimer's Disease. U.S. National Institutes of Health.
REF 19 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 20 Ensaculin (KA-672 HCl): a multitransmitter approach to dementia treatment. CNS Drug Rev. 2002 Summer;8(2):143-58.
REF 21 Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009.
REF 22 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037483)
REF 23 Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
REF 24 ClinicalTrials.gov (NCT01489969) Sleep Laboratory Study to Investigate the Safety and Efficacy of Neu-P11 in Primary Insomnia Patients. U.S. National Institutes of Health.
REF 25 Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66.
REF 26 ClinicalTrials.gov (NCT00000189) Gepirone vs Placebo in Treatment of Cocaine Dependence - 3. U.S. National Institutes of Health.
REF 27 ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health.
REF 28 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 26).
REF 29 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002186)
REF 30 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 167).
REF 31 S 16924 ((R)-2-[1-[2-(2,3-dihydro-benzo[1,4] dioxin-5-Yloxy)-ethyl]-pyrrolidin-3yl]-1-(4-fluoro-phenyl)-ethanone), a novel, potential antipsychotic with marked serotonin (5-HT)1A agonist properties: I. Receptorial and neurochemical profile in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1998 Sep;286(3):1341-55.
REF 32 S-16924 [(R)-2-[1-[2-(2,3-dihydro-benzo[1,4]dioxin-5-yloxy)-ethyl]- pyrrolidin-3yl]-1-(4-fluorophenyl)-ethanone], a novel, potential antipsychotic with marked serotonin1A agonist properties: III. Anxiolytic actions in comparison with clozapine and haloperidol. J Pharmacol Exp Ther. 1999 Mar;288(3):1002-14.
REF 33 The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
REF 34 Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7.
REF 35 ClinicalTrials.gov (NCT00272909) Efficacy of SUN N4057 in Subjects With Acute Ischemic Stroke and Measurable Penumbra on Magnetic Resonance Imaging (MRI). U.S. National Institutes of Health.
REF 36 Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals.
REF 37 Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals.
REF 38 Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals.
REF 39 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 58).
REF 40 The serotonin 5-HT receptor agonist tandospirone improves executive function in common marmosets. Behav Brain Res. 2015 Jul 1;287:120-6.
REF 41 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42.
REF 42 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412)
REF 43 ClinicalTrials.gov (NCT01774747) A Multiple Ascending Oral Dose Evaluation of the Safety, Tolerability, and Pharmacokinetics of DSP-1053 and Its Metabolites in Healthy Subjects and in Subjects With Major Depressive Disorder. U.S. National Institutes of Health.
REF 44 ClinicalTrials.gov (NCT00664365) FTIH Study With GSK958108. U.S. National Institutes of Health.
REF 45 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 46 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698)
REF 47 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689.
REF 48 mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706.
REF 49 Caspase inhibitors: a review of recently patented compounds (2013-2015).Expert Opin Ther Pat. 2018 Jan;28(1):47-59.
REF 50 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 17).
REF 51 Psychopathology and psychophysiology of minimal LSD-25 dosage; a preliminary dosage-response spectrum. AMA Arch Neurol Psychiatry. 1958 Feb;79(2):208-10.
REF 52 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8).
REF 53 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000679)
REF 54 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1).
REF 55 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001126)
REF 56 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001421)
REF 57 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004776)
REF 58 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014469)
REF 59 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026154)
REF 60 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001441)
REF 61 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 74).
REF 62 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010455)
REF 63 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 72).
REF 64 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006370)
REF 65 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000677)
REF 66 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422)
REF 67 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013610)
REF 68 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006909)
REF 69 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010848)
REF 70 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531)
REF 71 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001415)
REF 72 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001433)
REF 73 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002172)
REF 74 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029346)
REF 75 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002258)
REF 76 Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32.
REF 77 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001927)
REF 78 Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82.
REF 79 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003558)
REF 80 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 42).
REF 81 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000695)
REF 82 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 19).
REF 83 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003567)
REF 84 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430)
REF 85 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 24).
REF 86 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001368)
REF 87 Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology &#38 Therapeutics. 02/1999; 65(2).
REF 88 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 80).
REF 89 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002783)
REF 90 Effects of brexpiprazole, a novel serotonin-dopamine activity modulator, on phencyclidine-induced cognitive deficits in mice: a role for serotonin 5-HT1A receptors.Pharmacol Biochem Behav.2014 Sep;124:245-9.
REF 91 Brexpiprazole: First Global Approval.Drugs.2015 Sep;75(14):1687-97.
REF 92 Synthesis of new derivatives of 8-OH-DPAT: Influence of substitution on the aromatic ring on the pharmacological profile, Bioorg. Med. Chem. Lett. 3(10):2035-2038 (1993).
REF 93 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
REF 94 Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
REF 95 Urapidil. A reappraisal of its use in the management of hypertension. Drugs. 1998 Nov;56(5):929-55.
REF 96 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127)
REF 97 Pharma & Vaccines. Product Development Pipeline. April 29 2009.
REF 98 A positron emission tomography study to assess binding of lecozotan, a novel 5-hydroxytryptamine-1A silent antagonist, to brain 5-HT1A receptors in... Clin Pharmacol Ther. 2008 Jan;83(1):86-96.
REF 99 Dual ligands targeting dopamine D2 and serotonin 5-HT1A receptors as new antipsychotical or anti-Parkinsonian agents.Curr Med Chem.2014;21(4):437-57.
REF 100 Clinical pipeline report, company report or official report of Jazz Pharmaceuticals.
REF 101 The discriminative stimulus effects of KA 672, a putative cognitive enhancer: evidence for a 5-HT1A component. Pharmacol Biochem Behav. 1998 Jul;60(3):703-7.
REF 102 Company report (Minerva Neurosciences),MIN-101,Schizophrenia, 6 trials completed; Once a day formulation completed , Phase IIa completed; Phase IIb enrollment ongoing and expected to continue over the last 3 quarters of 2015.
REF 103 Clinical pipeline report, company report or official report of Neurim Pharmaceuticals.
REF 104 Antidepressant-like responses to the combined sigma and 5-HT1A receptor agonist OPC-14523. Neuropharmacology. 2001 Dec;41(8):976-88.
REF 105 Antagonism of the 5-HT1A receptor stimulus in a conditioned taste aversion procedure. Eur Neuropsychopharmacol. 1999 Jun;9(4):345-9.
REF 106 Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271
REF 107 EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22.
REF 108 S 15535, a benzodioxopiperazine acting as presynaptic agonist and postsynaptic 5-HT1A receptor antagonist, prevents the impairment of spatial learning caused by intrahippocampal scopolamine. Br J Pharmacol. 1999 Nov;128(6):1207-14.
REF 109 Labelling of recombinant human and native rat serotonin 5-HT1A receptors by a novel, selective radioligand, [3H]-S 15535: definition of its binding profile using agonists, antagonists and inverse agonists. Naunyn Schmiedebergs Arch Pharmacol. 1998 Mar;357(3):205-17.
REF 110 DOI: 10.1038/sj.mp.4002062
REF 111 Experimental study of pharmacological hypothermia: enhanced neuroprotective effect of a novel 5-HT 1 A agonist SUN N4057 by the pharmacological hypothermia. No To Shinkei. 2001 Sep;53(9):853-8.
REF 112 Company report (Fabrekramer)
REF 113 50 years of hurdles and hope in anxiolytic drug discovery. Nat Rev Drug Discov. 2013 Sep;12(9):667-87.
REF 114 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032503)
REF 115 Clinical pipeline report, company report or official report of Fabre-Kramer Pharmaceuticals.
REF 116 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025412)
REF 117 DSP-1053, a novel serotonin reuptake inhibitor with 5-HT1A partial agonistic activity, displays fast antidepressant effect with minimal undesirable effects in juvenile rats. Pharmacol Res Perspect. 2015 Jun;3(3):e00142.
REF 118 Clinical pipeline report, company report or official report of GlaxoSmithKline.
REF 119 In vivo electrophysiological and neurochemical effects of the selective 5-HT1A receptor agonist, F13640, at pre- and postsynaptic 5-HT1A receptors in the rat.Psychopharmacology (Berl).2012 May;221(2):261-72.
REF 120 SSR181507, a dopamine D receptor and 5-HT() receptor ligand: evidence for mixed anxiolytic- and antidepressant-like activities.Pharmacol Biochem Behav.2011 Jan;97(3):428-35.
REF 121 The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96.
REF 122 Stereoselective LSD-like activity in a series of d-lysergic acid amides of (R)- and (S)-2-aminoalkanes. J Med Chem. 1995 Mar 17;38(6):958-66.
REF 123 Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86.
REF 124 BMY 14802, a sigma receptor ligand for the treatment of schizophrenia. Neuropsychopharmacology. 1994 Feb;10(1):37-40.
REF 125 The effects of BMY-14802 against L-DOPA- and dopamine agonist-induced dyskinesia in the hemiparkinsonian rat
REF 126 Effect of sustained administration of the 5-HT1A receptor agonist flesinoxan on rat 5-HT neurotransmission. Eur Neuropsychopharmacol. 1999 Sep;9(5):427-40.
REF 127 An integrated in silico 3D model-driven discovery of a novel, potent, and selective amidosulfonamide 5-HT1A agonist (PRX-00023) for the treatment o... J Med Chem. 2006 Jun 1;49(11):3116-35.
REF 128 Synthesis and biological activity of the putative metabolites of the atypical antipsychotic agent tiospirone. J Med Chem. 1991 Nov;34(11):3316-28.
REF 129 Synthesis and SAR of adatanserin: novel adamantyl aryl- and heteroarylpiperazines with dual serotonin 5-HT(1A) and 5-HT(2) activity as potential anxiolytic and antidepressant agents. J Med Chem. 1999Dec 16;42(25):5077-94.
REF 130 Chronic alnespirone-induced desensitization of somatodendritic 5-HT1A autoreceptors in the rat dorsal raphe nucleus. Eur J Pharmacol. 1999 Jan 22;365(2-3):165-73.
REF 131 The effects of AP521, a novel anxiolytic drug, in three anxiety models and on serotonergic neural transmission in rats. J Pharmacol Sci. 2015 Jan;127(1):109-16.
REF 132 5-Hydroxytryptamine1A receptor occupancy by novel full antagonist 2-[4-[4-(7-chloro-2,3-dihydro-1,4-benzdioxyn-5-yl)-1-piperazinyl]butyl]-1,2-benzisothiazol-3-(2H)-one-1,1-dioxide: a[11C][O-methyl-3H]-N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide trihydrochloride (WAY-100635) positron emission tomography study in humans. J Pharmacol Exp Ther. 2002 Jun;301(3):1144-50.
REF 133 Effect of acute administration of the 5-HT1A receptor ligand, lesopitron, on rat cortical 5-HT and dopamine turnover. Br J Pharmacol. 1994 Oct;113(2):425-30.
REF 134 A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2.
REF 135 PRX-00023, a selective serotonin 1A receptor agonist, reduces ultrasonic vocalizations in infant rats bred for high infantile anxiety.Pharmacol Biochem Behav.2009 Nov;94(1):8-15.
REF 136 N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-nitrophenyl) cyclohexanecarboxamide: a novel pre- and postsynaptic 5-hydroxytryptamine(1A) receptor antagonist active on the lower urinary tract. JPharmacol Exp Ther. 2001 Dec;299(3):1027-37.
REF 137 Use of PET and the radioligand [carbonyl-(11)C]WAY-100635 in psychotropic drug development. Nucl Med Biol. 2000 Jul;27(5):515-21.
REF 138 Quantifying the 5-HT1A agonist action of buspirone in man. Psychopharmacology (Berl). 2001 Nov;158(3):224-9.
REF 139 A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14.
REF 140 In vitro interactions between a potential muscle relaxant E2101 and human cytochromes P450. Drug Metab Dispos. 2002 Jul;30(7):805-13.
REF 141 The pharmacological profile of (R)-3,4-dihydro-N-isopropyl-3-(N-isopropyl-N-propylamino)-2H-1-benzopyran-5-carboxamide, a selective 5-hydroxytryptamine(1A) receptor agonist. J Pharmacol Exp Ther. 2001 Dec;299(3):883-93.
REF 142 The use of sleep measures to compare a new 5HT1A agonist with buspirone in humans. J Psychopharmacol. 2005 Nov;19(6):609-13.
REF 143 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003531)
REF 144 Simultaneous determination of nerisopam, a novel anxiolytic agent showing polymorphic metabolism, and its N-acetyl metabolite from human plasma by a validated high performance liquid chromatographic method. J Chromatogr B Biomed Appl. 1996 Mar 29;678(1):63-72.
REF 145 Synthesis and dual D2 and 5-HT1A receptor binding affinities of 7-piperazinyl and 7-piperidinyl-3,4-dihydroquinazolin-2(1H)-ones. Med Chem. 2014;10(5):484-96.
REF 146 Effects of SUN 8399, a potent and selective 5-HT1A agonist, on conflict behavior and ambulatory activity in mice: comparison with those of buspirone, tandospirone and diazepam. Jpn J Pharmacol. 1994 Apr;64(4):273-80.
REF 147 Tolerance development to the vagal-mediated bradycardia produced by 5-HT1A receptor agonists. J Pharmacol Exp Ther. 1994 Nov;271(2):776-81.
REF 148 CN patent application no. 104151292, Indole derivative or a pharmaceutically acceptable salt thereof.
REF 149 Cardiovascular activity of A-74283, a 5-hydroxytryptamine 1A agent, in the spontaneously hypertensive rat. Pharmacology. 1998 Jan;56(1):17-29.
REF 150 Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43.
REF 151 8-[4-[2-(1,2,3,4-Tetrahydroisoquinolinyl]butyl-8-azaspiro[4.5]decane-7,9-dione: a new 5-HT1A receptor ligand with the same activity profile as busp... J Med Chem. 1996 Mar 1;39(5):1125-9.
REF 152 Quantitative determination of CGS 18102A, a new anxiolytic, in human plasma using capillary gas chromatography/mass spectrometry. Biomed Chromatogr. 1992 Sep-Oct;6(5):244-7.
REF 153 Synthesis, SAR and pharmacology of CP-293,019: a potent, selective dopamine D4 receptor antagonist. Bioorg Med Chem Lett. 1998 Apr 7;8(7):725-30.
REF 154 Neither in vivo MRI nor behavioural assessment indicate therapeutic efficacy for a novel 5HT1A agonist in rat models of ischaemic stroke. BMC Neuroscience 2009, 10:82.
REF 155 Pharmacological profile of (-)HT-90B, a novel 5-HT1A receptor agonist/5-HT2 receptor antagonist. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1201-16.
REF 156 Chronic voluntary ethanol intake hypersensitizes 5-HT(1A) autoreceptors in C57BL/6J mice. J Neurochem. 2008 Dec;107(6):1660-70.
REF 157 Pharmacological characterization of LY293284: A 5-HT1A receptor agonist with high potency and selectivity. J Pharmacol Exp Ther. 1994 Sep;270(3):1270-81.
REF 158 Influence of 5-HT1A receptor antagonism on plus-maze behaviour in mice. II. WAY 100635, SDZ 216-525 and NAN-190. Pharmacol Biochem Behav. 1997 Oct;58(2):593-603.
REF 159 Piperazinylalkyl heterocycles as potential antipsychotic agents. J Med Chem. 1995 Oct 13;38(21):4198-210.
REF 160 S 14506: novel receptor coupling at 5-HT(1A) receptors. Neuropharmacology. 2001 Mar;40(3):334-44.
REF 161 Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9.
REF 162 Pharmacological characterization of recombinant human 5-hydroxytryptamine1A receptors using a novel antagonist radioligand, [3H]WAY-100635. Life Sci. 1997;60(9):653-65.
REF 163 Cocaine and serotonin: a role for the 5-HT(1A) receptor site in the mediation of cocaine stimulant effects. Behav Brain Res. 2001 Nov 29;126(1-2):127-33.
REF 164 Involvement of 5-hydroxytryptamine(1A) receptors in nicotine-induced tail tremor in rats. Eur J Pharmacol. 2000 Nov 10;408(1):19-23.
REF 165 Synthesis of (R,S)-trans-8-hydroxy-2-[N-n-propyl-N-(3'-iodo-2'-propenyl)amino]tetral in (trans-8-OH-PIPAT): a new 5-HT1A receptor ligand. J Med Chem. 1993 Oct 15;36(21):3161-5.
REF 166 Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. J Med Chem. 1986 May;29(5):630-4.
REF 167 R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30.
REF 168 Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. Bioorg Med Chem. 2008 Jul 15;16(14):6675-81.
REF 169 The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl). 2001 Aug;157(1):111-4.
REF 170 5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. J Med Chem. 1986 Nov;29(11):2375-80.
REF 171 Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7.
REF 172 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28.
REF 173 5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. J Med Chem. 1986 Feb;29(2):194-9.
REF 174 Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7.
REF 175 Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7.
REF 176 Activity of aromatic substituted phenylpiperazines lacking affinity for dopamine binding sites in a preclinical test of antipsychotic efficacy. J Med Chem. 1989 May;32(5):1052-6.
REF 177 Pyrimido[5,4-b]indole derivatives. 1. A new class of potent and selective alpha 1 adrenoceptor ligands. J Med Chem. 1991 Jun;34(6):1850-4.
REF 178 Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new ... J Med Chem. 1994 Aug 19;37(17):2754-60.
REF 179 Identification of a red-emitting fluorescent ligand for in vitro visualization of human serotonin 5-HT(1A) receptors. Bioorg Med Chem Lett. 2010 Nov 15;20(22):6628-32.
REF 180 The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66.
REF 181 5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. J Med Chem. 1997 Nov 21;40(24):3974-8.
REF 182 Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. J Med Chem. 2006 Nov 2;49(22):6607-13.
REF 183 Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. J Med Chem. 2005 Jan 13;48(1):266-73.
REF 184 Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31.
REF 185 Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997).
REF 186 Novel aminoethylbiphenyls as 5-HT7 receptor ligands. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3018-22.
REF 187 SAR studies on new bis-aryls 5-HT7 ligands: Synthesis and molecular modeling. Bioorg Med Chem. 2010 Mar 1;18(5):1958-67.
REF 188 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997).
REF 189 A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem. 2003 Sep 11;46(19):4188-95.
REF 190 3-(1,2,5,6-Tetrahydropyrid-4-yl)pyrrolo[3,2-b]pyrid-5-one: a potent and selective serotonin (5-HT1B) agonist and rotationally restricted phenolic a... J Med Chem. 1990 Aug;33(8):2087-93.
REF 191 New generation dopaminergic agents. 2. Discovery of 3-OH-phenoxyethylamine and 3-OH-N1-phenylpiperazine dopaminergic templates. Bioorg Med Chem Lett. 1998 Feb 3;8(3):295-300.
REF 192 6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. J Med Chem. 1992 Oct 30;35(22):3984-90.
REF 193 Indoloxypropanolamine analogues as 5-HT(1A) receptor antagonists. Bioorg Med Chem Lett. 2007 Oct 15;17(20):5600-4.
REF 194 Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
REF 195 Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61.
REF 196 Agonist activity of antimigraine drugs at recombinant human 5-HT1A receptors: potential implications for prophylactic and acute therapy. Naunyn Schmiedebergs Arch Pharmacol. 1997 Jun;355(6):682-8.
REF 197 Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73.
REF 198 cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8.
REF 199 Ergolines as selective 5-HT1 agonists. J Med Chem. 1988 Aug;31(8):1512-9.
REF 200 SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20.
REF 201 WO patent application no. 2012,0025,83, Method for treating schizophrenia and related diseases with a combination therapy.
REF 202 Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40.
REF 203 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1).
REF 204 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8.
REF 205 Diagnosis of migraine with aura, depression and anxiety from allelic variations in dopaminergic genes
REF 206 Alkaloids from Eschscholzia californica and their capacity to inhibit binding of [3H]8-Hydroxy-2-(di-N-propylamino)tetralin to 5-HT1A receptors in ... J Nat Prod. 2006 Mar;69(3):432-5.
REF 207 Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-... J Med Chem. 1985 Oct;28(10):1540-2.
REF 208 Agonist and antagonist actions of antipsychotic agents at 5-HT1A receptors: a [35S]GTPgammaS binding study. Eur J Pharmacol. 1998 Aug 21;355(2-3):245-56.
REF 209 Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69.
REF 210 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001.
REF 211 Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21.
REF 212 Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor act... J Med Chem. 2008 Sep 25;51(18):5813-22.
REF 213 Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23.
REF 214 Arylpiperazine derivatives as high-affinity 5-HT1A serotonin ligands. J Med Chem. 1988 Oct;31(10):1968-71.
REF 215 p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90.
REF 216 A 18F-MPPF PET normative database of 5-HT1A receptor binding in men and women over aging. J Nucl Med. 2005 Dec;46(12):1980-9.
REF 217 New sigma and 5-HT1A receptor ligands: omega-(tetralin-1-yl)-n-alkylamine derivatives. J Med Chem. 1996 Jan 5;39(1):176-82.
REF 218 Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46.
REF 219 Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804.
REF 220 Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characteri... J Med Chem. 2009 Nov 12;52(21):6946-50.
REF 221 Characterization of the aminomethylchroman derivative BAY x 3702 as a highly potent 5-hydroxytryptamine1A receptor agonist. J Pharmacol Exp Ther. 1998 Mar;284(3):1082-94.
REF 222 Interaction of the anxiogenic agent, RS-30199, with 5-HT1A receptors: modulation of sexual activity in the male rat. Neuropharmacology. 1998 Jun;37(6):769-80.
REF 223 SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806.
REF 224 Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80.
REF 225 Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43.
REF 226 Novel 3-aminochromans as potential pharmacological tools for the serotonin 5-HT(7) receptor. Bioorg Med Chem Lett. 2005 Feb 1;15(3):747-50.
REF 227 Synthesis and structure-activity relationship of fluoro analogues of 8-{2-[4-(4-methoxyphenyl)piperazin-1yl]ethyl}-8-azaspiro[4.5]decane-7,9-dione ... J Med Chem. 2005 Apr 21;48(8):3076-9.
REF 228 Effect of SR 59026A, a new 5-HT(1A) receptor agonist, on sexual activity in male rats. Behav Pharmacol. 1995 Apr;6(3):276-282.
REF 229 Characterization of U-92016A as a selective, orally active, high intrinsic activity 5-hydroxytryptamine1A agonist. J Pharmacol Exp Ther. 1994 Nov;271(2):875-83.
REF 230 (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997).
REF 231 N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. J Med Chem. 1997 Apr 11;40(8):1252-7.
REF 232 Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. J Med Chem. 2005 Jan 27;48(2):353-6.
REF 233 [11C]-WAY100635 PET demonstrates marked 5-HT1A receptor changes in sporadic ALS. Brain. 2005 Apr;128(Pt 4):896-905.
REF 234 Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10.
REF 235 [(3)H]-F13640, a novel, selective and high-efficacy serotonin 5-HT(1A) receptor agonist radioligand. Naunyn Schmiedebergs Arch Pharmacol. 2010 Oct;382(4):321-30.
REF 236 Ligand binding characteristics of the human serotonin1A receptor heterologously expressed in CHO cells. Biosci Rep. 2004 Apr;24(2):101-15.
REF 237 Receptor binding characteristics of [3H]NAD-299, a new selective 5-HT1A receptor antagonist. Eur J Pharmacol. 1998 Nov 6;360(2-3):219-25.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.