Target Information

Target General Infomation
Target ID
T82277 (Former ID: TTDNC00483)
Target Name
Cancer/testis antigen 1 (NY-ESO-1)
Synonyms
LAGE2B; LAGE2A; LAGE2; LAGE-2; L antigen family member 2; ESO1; Cancer/testis antigen 6.1; CTAG1B; CTAG1; CTAG; CT6.1; Autoimmunogenic cancer/testis antigen NYESO1; Autoimmunogenic cancer/testis antigen NY-ESO-1
Gene Name
CTAG1A
Target Type
Clinical trial target
 [1]
Disease [+] 7 Target-related Diseases +
1 Ovarian cancer [ICD-11: 2C73]
2 Solid tumour/cancer [ICD-11: 2A00-2F9Z]
3 Esophageal cancer [ICD-11: 2B70]
4 Lung cancer [ICD-11: 2C25]
5 Multiple myeloma [ICD-11: 2A83]
6 Synovial sarcoma [ICD-11: 2B5A]
7 Melanoma [ICD-11: 2C30]
Function
Immunogenic protein. Its aberrant re-expression is induced by molecular mechanisms including: DNA demethylation, histone post-translational modification, and microRNA-mediated regulation. The effect of DNA demethylation is evident by the capability of demethylating agents, like 5-aza-2-deoxycytidine, to induce the re-expression of NY-ESO-1 in tumour cells but not in normal epithelial cells.
UniProt ID
CTG1B_HUMAN
Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA
PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG
VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 5 Clinical Trial Drugs +
1 CDX-1401 Drug Info Phase 2 Solid tumour/cancer [2]
2 Anti-NY-ESO-1 CAR-T cells Drug Info Phase 1/2 Esophageal cancer [3]
3 CV-9201 Drug Info Phase 1/2 Non-small-cell lung cancer [4]
4 GSK-2241658A Drug Info Phase 1 Melanoma [5]
5 NY-ESO-1 vaccine Drug Info Phase 1 Solid tumour/cancer [6]
Discontinued Drug(s) [+] 1 Discontinued Drugs +
1 Melanoma vaccine (ALVAC) Drug Info Discontinued in Phase 2 Melanoma [7]
Mode of Action [+] 2 Modes of Action +
Modulator [+] 1 Modulator drugs +
1 CDX-1401 Drug Info [1]
CAR-T-Cell-Therapy [+] 1 CAR-T-Cell-Therapy drugs +
1 Anti-NY-ESO-1 CAR-T cells Drug Info [3]
References
REF 1 National Cancer Institute Drug Dictionary (drug id 651880).
REF 2 ClinicalTrials.gov (NCT02129075) CDX-1401 and Poly-ICLC Vaccine Therapy With or Without CDX-301in Treating Patients With Stage IIB-IV Melanoma. U.S. National Institutes of Health.
REF 3 ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
REF 4 ClinicalTrials.gov (NCT00923312) Trial of an RNActive-Derived Cancer Vaccine in Stage IIIB/IV Non Small Cell Lung Cancer (NSCLC). U.S. National Institutes of Health.
REF 5 ClinicalTrials.gov (NCT01213472) Evaluation of a New Anti-cancer Immunotherapy in Patients With Non-operable and Progressing Metastatic Cutaneous Melanoma. U.S. National Institutes of Health.
REF 6 ClinicalTrials.gov (NCT00199836) A Pilot Study of NY-ESO-1b Peptide Plus CpG 7909 and Montanide ISA-51 in Patients With Cancer.. U.S. National Institutes of Health.
REF 7 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153)
REF 8 National Cancer Institute Drug Dictionary (drug id 648549).
REF 9 Multiepitope CD8+ T cell response to a NY-ESO-1 peptide vaccine results in imprecise tumor targeting. J Clin Invest. 2002 December 15; 110(12): 1813-1822.
REF 10 Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.