Target General Infomation
Target ID
T86323
Target Name
Neural cell adhesion molecule 1 (NCAM1)
Synonyms
NCAM-1; NCAM; N-CAM-1; MSK39; CD56
Gene Name
NCAM1
Target Type
Clinical trial target
[1]
Disease [+] 3 Target-related Diseases +
1 Acute myeloid leukaemia [ICD-11: 2A60]
2 Myelodysplastic syndrome [ICD-11: 2A37]
3 Multiple myeloma [ICD-11: 2A83]
Function
This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
UniProt ID
NCAM1_HUMAN
Sequence
MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF
KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF
PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI
HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE
KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG
PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDS
ENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI
LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAA
SEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI
RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLS
TGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFS
KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE
VKTVPNDATQTKENESKA
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 4 Clinical Trial Drugs +
1 CD56 CAR T cells Drug Info Phase 1/2 Multiple myeloma [2]
2 CD56-specific gene-engineered T cells Drug Info Phase 1/2 Acute myeloid leukaemia [1]
3 CART-56 cells Drug Info Phase 1 Myelodysplastic syndrome [3]
4 CAR-T cells targeting CD56 Drug Info Clinical trial Multiple myeloma [4]
Mode of Action [+] 1 Modes of Action +
CAR-T-Cell-Therapy [+] 4 CAR-T-Cell-Therapy drugs +
1 CD56 CAR T cells Drug Info [2]
2 CD56-specific gene-engineered T cells Drug Info [1]
3 CART-56 cells Drug Info [3]
4 CAR-T cells targeting CD56 Drug Info [4], [5]
Target Regulators
Target-interacting Proteins
Target Affiliated Biological Pathways
KEGG Pathway [+] 2 KEGG Pathways +
1 Cell adhesion molecules (CAMs)
2 Prion diseases
References
REF 1 ClinicalTrials.gov (NCT03222674) Multi-CAR T Cell Therapy for Acute Myeloid Leukemia
REF 2 ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma
REF 3 ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
REF 4 ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma
REF 5 ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.