Target General Infomation
Target ID
T88023 (Former ID: TTDR00192)
Target Name
Lymphocyte activation antigen CD30 (TNFRSF8)
Synonyms
Tumor necrosis factor receptor superfamily member 8; KI-1 antigen; D1S166E; CD30L receptor; CD30
Gene Name
TNFRSF8
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Hodgkin lymphoma [ICD-11: 2B30]
Function
May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B. Receptor for TNFSF8/CD30L.
UniProt ID
TNR8_HUMAN
Sequence
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Brentuximab vedotin Drug Info Approved Hodgkin lymphoma [2], [3], [4]
Clinical Trial Drug(s) [+] 17 Clinical Trial Drugs +
1 CAR-T cells targeting CD30 Drug Info Phase 2 Non-hodgkin lymphoma [5]
2 Iratumumab Drug Info Phase 2 Lymphoma [6]
3 SGN-30 Drug Info Phase 2 Solid tumour/cancer [7]
4 4SCAR19 and 4SCAR30 Drug Info Phase 1/2 B-cell lymphoma [8]
5 Anti-CD30 CAR T cells Drug Info Phase 1/2 Lymphoma [9]
6 Anti-CD30-CAR-transduced T cells Drug Info Phase 1/2 leukaemia [10]
7 CAR-T cells targeting CD30 Drug Info Phase 1/2 leukaemia [11]
8 CAR.CD30 cells Drug Info Phase 1/2 Immune System disease [12], [13]
9 CART30 Drug Info Phase 1/2 Non-hodgkin lymphoma [14]
10 Anti-CD30 CAR-T cells Drug Info Phase 1 leukaemia [15]
11 Anti-CD30-CAR T cells Drug Info Phase 1 Hodgkin lymphoma [16]
12 ATLCAR.CD30 cells Drug Info Phase 1 Immune System disease [17]
13 ATLCAR.CD30.CCR4 cells Drug Info Phase 1 Immune System disease [17]
14 CAR CD30 T cells Drug Info Phase 1 Non-hodgkin lymphoma [18]
15 CD30 CAR T Cells Drug Info Phase 1 Non-hodgkin lymphoma [19]
16 ICAR30 T cells Drug Info Phase 1 Anaplastic large cell lymphoma [20]
17 Xmab-2513 Drug Info Phase 1 Lymphoma [21]
Mode of Action [+] 3 Modes of Action +
Modulator [+] 2 Modulator drugs +
1 Brentuximab vedotin Drug Info [1]
2 VT-362 Drug Info [27]
CAR-T-Cell-Therapy [+] 12 CAR-T-Cell-Therapy drugs +
1 CAR-T cells targeting CD30 Drug Info [5]
2 Anti-CD30 CAR T cells Drug Info [9]
3 Anti-CD30-CAR-transduced T cells Drug Info [10]
4 CAR-T cells targeting CD30 Drug Info [11]
5 CART30 Drug Info [14]
6 Anti-CD30 CAR-T cells Drug Info [15]
7 Anti-CD30-CAR T cells Drug Info [16]
8 ATLCAR.CD30 cells Drug Info [17]
9 CAR CD30 T cells Drug Info [18]
10 CAR.CD30 cells Drug Info [12], [13]
11 CD30 CAR T Cells Drug Info [19]
12 ICAR30 T cells Drug Info [20]
CAR-T-Cell-Therapy(Dual specific) [+] 2 CAR-T-Cell-Therapy(Dual specific) drugs +
1 4SCAR19 and 4SCAR30 Drug Info [8]
2 ATLCAR.CD30.CCR4 cells Drug Info [17]
Target Regulators
Target-interacting Proteins
Target Affiliated Biological Pathways
KEGG Pathway [+] 1 KEGG Pathways +
1 Cytokine-cytokine receptor interaction
NetPath Pathway [+] 2 NetPath Pathways +
1 Leptin Signaling Pathway
2 TCR Signaling Pathway
References
REF 1 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6772).
REF 3 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
REF 4 ClinicalTrials.gov (NCT01990534) A Study of Brentuximab Vedotin in Patients With Relapsed or Refractory Hodgkin Lymphoma. U.S. National Institutes of Health.
REF 5 ClinicalTrials.gov (NCT03196830) CAR-T for R/R B-NHL
REF 6 ClinicalTrials.gov (NCT00284804) A Phase II Study of MDX-060 in Subjects With Relapsed or Refractory Hodgkin's Disease. U.S. National Institutes of Health.
REF 7 ClinicalTrials.gov (NCT00099255) Study of SGN-30 (Anti-CD30 mAb) in Patients With Primary Cutaneous Anaplastic Large Cell Lymphoma. U.S. National Institutes of Health.
REF 8 ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
REF 9 ClinicalTrials.gov (NCT02274584) CAR T Cells Targeting CD30 Positive Lymphomas (4SCAR30273)
REF 10 ClinicalTrials.gov (NCT02958410) A Clinical Research of CD30-Targeted CAR-T in Lymphocyte Malignancies
REF 11 ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 12 ClinicalTrials.gov (NCT02663297) Administration of T Lymphocytes for Prevention of Relapse of Lymphomas
REF 13 ClinicalTrials.gov (NCT02690545) Study of CD30 CAR for Relapsed/Refractory CD30+ HL and CD30+ NHL
REF 14 ClinicalTrials.gov (NCT02259556) CD30-directed Chimeric Antigen Receptor T (CART30) Therapy in Relapsed and Refractory CD30 Positive Lymphomas
REF 15 ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
REF 16 ClinicalTrials.gov (NCT03049449) T Cells Expressing a Fully-Human Anti-CD30 Chimeric Antigen Receptor for Treating CD30-Expressing Lymphomas
REF 17 ClinicalTrials.gov (NCT03602157) Study of CAR-T Cells Expressing CD30 and CCR4 for r/r CD30+ HL and NHL
REF 18 ClinicalTrials.gov (NCT01316146) Administration of T Lymphocytes for Hodgkin's Lymphoma and Non-Hodgkin's Lymphoma (CART CD30)
REF 19 ClinicalTrials.gov (NCT02917083) CD30 CAR T Cells, Relapsed CD30 Expressing Lymphoma (RELY-30)
REF 20 ClinicalTrials.gov (NCT03383965) CD30 Targeted CAR-T in Treating CD30-Expressing Lymphomas
REF 21 ClinicalTrials.gov (NCT00606645) Safety Study of XmAb2513 to Treat Hodgkin Lymphoma or Anaplastic Large Cell Lymphoma. U.S. National Institutes of Health.
REF 22 Utilizing CD30 expression as a rational target for therapy of lymphoma. J Hematol Oncol. 2012; 5(Suppl 1): A2.
REF 23 The anti-CD30 monoclonal antibody SGN-30 promotes growth arrest and DNA fragmentation in vitro and affects antitumor activity in models of Hodgkin's disease. Cancer Res. 2002 Jul 1;62(13):3736-42.
REF 24 Phase I study of an anti-CD30 Fc engineered humanized monoclonal antibody in Hodgkin lymphoma (HL) or anaplastic large cell lymphoma (ALCL) patients: Safety, pharmacokinetics (PK), immunogenicity, and efficacy. J Clin Oncol (Meeting Abstracts) May 2009 vol. 27 no. 15S 8531.
REF 25 Antitumor activity of anti-CD30 immunotoxin (Ber-H2/saporin) in vitro and in severe combined immunodeficiency disease mice xenografted with human CD30+ anaplastic large-cell lymphoma. Blood. 1995 Apr15;85(8):2139-46.
REF 26 Phase 1 trial of the novel bispecific molecule H22xKi-4 in patients with refractory Hodgkin lymphoma. Blood. 2002 Nov 1;100(9):3101-7.
REF 27 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1877).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.