Target General Infomation
Target ID
T93923 (Former ID: TTDNC00406)
Target Name
Co-stimulatory molecule 4-1BB (CD137)
Synonyms
Tumor necrosis factor receptor superfamily member 9; T-cell antigen ILA; T-cell antigen 4-1BB homolog; ILA; CDw137; 4-1BB ligand receptor
Gene Name
TNFRSF9
Target Type
Clinical trial target
[1]
Disease [+] 5 Target-related Diseases +
1 Solid tumour/cancer [ICD-11: 2A00-2F9Z]
2 Acute myeloid leukaemia [ICD-11: 2A60]
3 B-cell lymphoma [ICD-11: 2A86]
4 Mature B-cell lymphoma [ICD-11: 2A85]
5 Malignant haematopoietic neoplasm [ICD-11: 2B33]
Function
Possibly active during T cell activation. Receptor for TNFSF9/4-1BBL.
BioChemical Class
Cytokine receptor
UniProt ID
TNR9_HUMAN
Sequence
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGGCEL
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 6 Clinical Trial Drugs +
1 Anti-CD137 Drug Info Phase 2 Solid tumour/cancer [2]
2 Urelumab Drug Info Phase 2 Solid tumour/cancer [3], [4]
3 CD137 CAR-T Cell Drug Info Phase 1/2 Acute lymphoblastic leukaemia [5]
4 MG7-CART Drug Info Phase 1/2 Acute myeloid leukaemia [6]
5 CD28 and CD137 CAR-T Cells Drug Info Phase 1 Acute lymphoblastic leukaemia [7]
6 PF-05082566 Drug Info Phase 1 Non-hodgkin lymphoma [8]
Mode of Action [+] 4 Modes of Action +
CAR-T-Cell-Therapy [+] 2 CAR-T-Cell-Therapy drugs +
1 CD137 CAR-T Cell Drug Info [5]
2 MG7-CART Drug Info [6]
Agonist [+] 1 Agonist drugs +
1 Urelumab Drug Info [3]
CAR-T-Cell-Therapy(Dual specific) [+] 1 CAR-T-Cell-Therapy(Dual specific) drugs +
1 CD28 and CD137 CAR-T Cells Drug Info [7]
Modulator [+] 2 Modulator drugs +
1 PF-05082566 Drug Info [9]
2 HG-1051 Drug Info [1]
Target Regulators
Target-interacting Proteins
Target Affiliated Biological Pathways
KEGG Pathway [+] 1 KEGG Pathways +
1 Cytokine-cytokine receptor interaction
NetPath Pathway [+] 1 NetPath Pathways +
1 TCR Signaling Pathway
PID Pathway [+] 2 PID Pathways +
1 Downstream signaling in na&#xef
2
WikiPathways [+] 1 WikiPathways +
1 TCR Signaling Pathway
References
REF 1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1878).
REF 2 ClinicalTrials.gov (NCT00612664) Phase II, 2nd Line Melanoma - RAND Monotherapy. U.S. National Institutes of Health.
REF 3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 4 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 5 ClinicalTrials.gov (NCT02965092) CD19 Chimeric Antigen Receptor (CAR)-Modified T Cell Therapy in Treating Patients With B-cell Malignancies
REF 6 ClinicalTrials.gov (NCT02862704) A Study of MG7 Redirected Autologous T Cells for Advanced MG7 Positive Liver Metastases(MG7-CART)
REF 7 ClinicalTrials.gov (NCT02186860) Chimeric Antigen Receptor (CAR)-Modified T Cell Therapy in Treating Patients With Acute Lymphoblastic Leukemia
REF 8 ClinicalTrials.gov (NCT02179918) A Study Of 4-1BB Agonist PF-05082566 Plus PD-1 Inhibitor MK-3475 In Patients With Solid Tumors (B1641003/KEYNOTE-0036). U.S. National Institutes of Health.
REF 9 Targeting of 4-1BB by monoclonal antibody PF-05082566 enhances T-cell function and promotes anti-tumor activity. Cancer Immunol Immunother. 2012 Oct;61(10):1721-33.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.