Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T95371
(Former ID: TTDNC00373)
|
|||||
| Target Name |
Interferon alpha/beta receptor 1 (IFNAR1)
|
|||||
| Synonyms |
Type I interferon receptor 1; IFNalpha/beta receptor 1; IFNR1; IFNAR; IFN-alpha/beta receptor 1; IFN-R-1; Cytokine receptor family 2 member 1; Cytokine receptor classII member 1; Cytokine receptor class-II member 1; CRF21; CRF2-1
|
|||||
| Gene Name |
IFNAR1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Hepatitis virus infection [ICD-11: 1E50-1E51] | |||||
| 2 | Ovarian cancer [ICD-11: 2C73] | |||||
| Function |
Functions in general as heterodimer with IFNAR2. Type I interferon binding activates the JAK-STAT signaling cascade, and triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and the IFNR alpha- and beta-subunits themselves. Can form an active IFNB1 receptor by itself and activate a signaling cascade that does not involve activation of the JAK-STAT pathway. Component of the receptor for type I interferons, including interferons alpha, IFNB1 and IFNW1.
Click to Show/Hide
|
|||||
| BioChemical Class |
Cytokine receptor
|
|||||
| UniProt ID | ||||||
| Sequence |
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN EDESESKTSEELQQDFV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
| 1 | EMZ701 | Drug Info | Phase 2 | Hepatitis B virus infection | [2] | |
| 2 | MEDI-546 | Drug Info | Phase 2 | Ovarian cancer | [3], [4] | |
| 3 | R-IFN-1a | Drug Info | Phase 2 | Hepatitis C virus infection | [5] | |
| 4 | Zadaxin/lamivudine | Drug Info | Phase 2 | Hepatitis B virus infection | [6] | |
| 5 | Belerofon | Drug Info | Phase 1 | Hepatitis C virus infection | [7] | |
| Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
| 1 | Omega interferon | Drug Info | Discontinued in Phase 2 | Hepatitis C virus infection | [8] | |
| 2 | BLX-883 | Drug Info | Discontinued in Phase 1 | Hepatitis C virus infection | [9] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 8 Modulator drugs | + | ||||
| 1 | EMZ701 | Drug Info | [1] | |||
| 2 | MEDI-546 | Drug Info | [4] | |||
| 3 | R-IFN-1a | Drug Info | [10] | |||
| 4 | Zadaxin/lamivudine | Drug Info | [11] | |||
| 5 | Belerofon | Drug Info | [12] | |||
| 6 | Omega interferon | Drug Info | [13] | |||
| 7 | BLX-883 | Drug Info | [14] | |||
| 8 | Ceplene/Peg-Intron/Rebetol | Drug Info | [15] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 11 KEGG Pathways | + | ||||
| 1 | Cytokine-cytokine receptor interaction | |||||
| 2 | PI3K-Akt signaling pathway | |||||
| 3 | Osteoclast differentiation | |||||
| 4 | Toll-like receptor signaling pathway | |||||
| 5 | Jak-STAT signaling pathway | |||||
| 6 | Natural killer cell mediated cytotoxicity | |||||
| 7 | Hepatitis C | |||||
| 8 | Hepatitis B | |||||
| 9 | Measles | |||||
| 10 | Influenza A | |||||
| 11 | Herpes simplex infection | |||||
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | TCR Signaling Pathway | |||||
| 2 | Leptin Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | Inflammation mediated by chemokine and cytokine signaling pathway | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | Downstream signaling in naï | |||||
| 2 | ||||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Interferon alpha/beta signaling | |||||
| 2 | Regulation of IFNA signaling | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | Toll-like receptor signaling pathway | |||||
| 2 | Interferon type I signaling pathways | |||||
| 3 | Interferon alpha/beta signaling | |||||
| 4 | Regulation of toll-like receptor signaling pathway | |||||
| 5 | Osteoclast Signaling | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Patent EP2766021 A1. | |||||
| REF 2 | Clinical pipeline report, company report or official report of Transition Therapeutics. | |||||
| REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8258). | |||||
| REF 4 | Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody. MAbs. 2015;7(2):428-39. | |||||
| REF 5 | A phase II study of recombinant interferon-beta (r-hIFN-beta 1a) in combination with 5-fluorouracil (5-FU) in the treatment of patients with advanced colorectal carcinoma. Br J Cancer. 1997;75(3):423-6. | |||||
| REF 6 | Clinical pipeline report, company report or official report of SciClone. | |||||
| REF 7 | Nautilus Biotech Receives FDA Approval for Phase 1 Clinical Trial in the USA for Oral Belerofon(R), its Long-Lasting, Interferon-Alpha Drug. Nautilus Biotech. MAY 14, 2007. | |||||
| REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005492) | |||||
| REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021901) | |||||
| REF 10 | Further study on the specificity and incidence of neutralizing antibodies to interferon (IFN) in relapsing remitting multiple sclerosis patients treated with IFN beta-1a or IFN beta-1b. J Neurol Sci.1999 Oct 15;168(2):131-6. | |||||
| REF 11 | Zadaxin (thymosin alpha1) for the treatment of viral hepatitis. Expert Opin Investig Drugs. 1999 Mar;8(3):281-7. | |||||
| REF 12 | WO patent application no. 2009,0153,36, Controlled release interferon drug products and treatment of hcv infection using same. | |||||
| REF 13 | Human interferon omega--a review. Mult Scler. 1995;1 Suppl 1:S44-7. | |||||
| REF 14 | Patent CN103536906 A. | |||||
| REF 15 | Resistance to mericitabine, a nucleoside analogue inhibitor of HCV RNA-dependent RNA polymerase. Antivir Ther. 2012;17(3):411-23. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.