Target Information

Target General Infomation
Target ID
T95371 (Former ID: TTDNC00373)
Target Name
Interferon alpha/beta receptor 1 (IFNAR1)
Synonyms
Type I interferon receptor 1; IFNalpha/beta receptor 1; IFNR1; IFNAR; IFN-alpha/beta receptor 1; IFN-R-1; Cytokine receptor family 2 member 1; Cytokine receptor classII member 1; Cytokine receptor class-II member 1; CRF21; CRF2-1
Gene Name
IFNAR1
Target Type
Clinical trial target
 [1]
Disease [+] 2 Target-related Diseases +
1 Hepatitis virus infection [ICD-11: 1E50-1E51]
2 Ovarian cancer [ICD-11: 2C73]
Function
Functions in general as heterodimer with IFNAR2. Type I interferon binding activates the JAK-STAT signaling cascade, and triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and the IFNR alpha- and beta-subunits themselves. Can form an active IFNB1 receptor by itself and activate a signaling cascade that does not involve activation of the JAK-STAT pathway. Component of the receptor for type I interferons, including interferons alpha, IFNB1 and IFNW1.
BioChemical Class
Cytokine receptor
UniProt ID
INAR1_HUMAN
Sequence
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVT
FSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERI
ENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ
NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK
GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP
VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSN
EDESESKTSEELQQDFV
Drugs and Modes of Action
Clinical Trial Drug(s) [+] 5 Clinical Trial Drugs +
1 EMZ701 Drug Info Phase 2 Hepatitis B virus infection [2]
2 MEDI-546 Drug Info Phase 2 Ovarian cancer [3], [4]
3 R-IFN-1a Drug Info Phase 2 Hepatitis C virus infection [5]
4 Zadaxin/lamivudine Drug Info Phase 2 Hepatitis B virus infection [6]
5 Belerofon Drug Info Phase 1 Hepatitis C virus infection [7]
Discontinued Drug(s) [+] 2 Discontinued Drugs +
1 Omega interferon Drug Info Discontinued in Phase 2 Hepatitis C virus infection [8]
2 BLX-883 Drug Info Discontinued in Phase 1 Hepatitis C virus infection [9]
Mode of Action [+] 1 Modes of Action +
Modulator [+] 8 Modulator drugs +
1 EMZ701 Drug Info [1]
2 MEDI-546 Drug Info [4]
3 R-IFN-1a Drug Info [10]
4 Zadaxin/lamivudine Drug Info [11]
5 Belerofon Drug Info [12]
6 Omega interferon Drug Info [13]
7 BLX-883 Drug Info [14]
8 Ceplene/Peg-Intron/Rebetol Drug Info [15]
Target Regulators
Target-regulating microRNAs
Target-regulating microRNAs Info 
Target-interacting Proteins
Target-interacting Proteins Info 
Target Affiliated Biological Pathways
KEGG Pathway [+] 11 KEGG Pathways +
1 Cytokine-cytokine receptor interaction
2 PI3K-Akt signaling pathway
3 Osteoclast differentiation
4 Toll-like receptor signaling pathway
5 Jak-STAT signaling pathway
6 Natural killer cell mediated cytotoxicity
7 Hepatitis C
8 Hepatitis B
9 Measles
10 Influenza A
11 Herpes simplex infection
NetPath Pathway [+] 2 NetPath Pathways +
1 TCR Signaling Pathway
2 Leptin Signaling Pathway
Panther Pathway [+] 1 Panther Pathways +
1 Inflammation mediated by chemokine and cytokine signaling pathway
PID Pathway [+] 2 PID Pathways +
1 Downstream signaling in na&#xef
2
Reactome [+] 2 Reactome Pathways +
1 Interferon alpha/beta signaling
2 Regulation of IFNA signaling
WikiPathways [+] 5 WikiPathways +
1 Toll-like receptor signaling pathway
2 Interferon type I signaling pathways
3 Interferon alpha/beta signaling
4 Regulation of toll-like receptor signaling pathway
5 Osteoclast Signaling
References
REF 1 Patent EP2766021 A1.
REF 2 Clinical pipeline report, company report or official report of Transition Therapeutics.
REF 3 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8258).
REF 4 Molecular basis for antagonistic activity of anifrolumab, an anti-interferon-alpha receptor 1 antibody. MAbs. 2015;7(2):428-39.
REF 5 A phase II study of recombinant interferon-beta (r-hIFN-beta 1a) in combination with 5-fluorouracil (5-FU) in the treatment of patients with advanced colorectal carcinoma. Br J Cancer. 1997;75(3):423-6.
REF 6 Clinical pipeline report, company report or official report of SciClone.
REF 7 Nautilus Biotech Receives FDA Approval for Phase 1 Clinical Trial in the USA for Oral Belerofon(R), its Long-Lasting, Interferon-Alpha Drug. Nautilus Biotech. MAY 14, 2007.
REF 8 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005492)
REF 9 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021901)
REF 10 Further study on the specificity and incidence of neutralizing antibodies to interferon (IFN) in relapsing remitting multiple sclerosis patients treated with IFN beta-1a or IFN beta-1b. J Neurol Sci.1999 Oct 15;168(2):131-6.
REF 11 Zadaxin (thymosin alpha1) for the treatment of viral hepatitis. Expert Opin Investig Drugs. 1999 Mar;8(3):281-7.
REF 12 WO patent application no. 2009,0153,36, Controlled release interferon drug products and treatment of hcv infection using same.
REF 13 Human interferon omega--a review. Mult Scler. 1995;1 Suppl 1:S44-7.
REF 14 Patent CN103536906 A.
REF 15 Resistance to mericitabine, a nucleoside analogue inhibitor of HCV RNA-dependent RNA polymerase. Antivir Ther. 2012;17(3):411-23.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.