Target General Infomation
Target ID
T98052 (Former ID: TTDI02305)
Target Name
SLAM family member 7 SLAMF7 (CS1)
Synonyms
UNQ576/PRO1138; SLAM family member 7; Protein 19A; Novel Ly9; Membrane protein FOAP-12; CRACC; CD319; CD2-like receptor-activating cytotoxic cells; CD2 subset 1
Gene Name
SLAMF7
Target Type
Successful target
[1]
Disease [+] 1 Target-related Diseases +
1 Multiple myeloma [ICD-11: 2A83]
Function
SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines. Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family.
BioChemical Class
Immunoglobulin
UniProt ID
SLAF7_HUMAN
Sequence
MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPL
VTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEY
VLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSIL
PISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSL
FVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA
NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI
Drugs and Modes of Action
Approved Drug(s) [+] 1 Approved Drugs +
1 Elotuzumab Drug Info Approved Multiple myeloma [2], [3], [4]
Clinical Trial Drug(s) [+] 3 Clinical Trial Drugs +
1 PVX-410 Drug Info Phase 2 Multiple myeloma [4], [5], [6], [7]
2 ABBV-838 Drug Info Phase 1 Multiple myeloma [4]
3 CS1-CAR T Therapy Drug Info Phase 1 Plasma cell myeloma [8]
Mode of Action [+] 3 Modes of Action +
Modulator [+] 1 Modulator drugs +
1 PVX-410 Drug Info [1], [9]
Inhibitor [+] 1 Inhibitor drugs +
1 ABBV-838 Drug Info [4]
CAR-T-Cell-Therapy [+] 1 CAR-T-Cell-Therapy drugs +
1 CS1-CAR T Therapy Drug Info [8]
Target Profiles in Patients
Target Expression
 Profile (TEP)
References
REF 1 Market watch: Upcoming catalysts in Q2 2015. Nat Rev Drug Discov. 2015 Apr;14(4):228.
REF 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8361).
REF 3 ClinicalTrials.gov (NCT01335399) Phase III Study of Lenalidomide and Dexamethasone With or Without Elotuzumab to Treat Newly Diagnosed, Previously Untreated Multiple Myeloma. U.S. National Institutesof Health.
REF 4 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 5 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 6 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 7 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 8 ClinicalTrials.gov (NCT03710421) CS1-CAR T Therapy Following Chemotherapy in Treating Patients With Relapsed or Refractory Multiple Myeloma
REF 9 Combinatorial efficacy of anti-CS1 monoclonal antibody elotuzumab (HuLuc63) and bortezomib against multiple myeloma. Mol Cancer Ther. 2009 Sep;8(9):2616-24.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.