| Target General Information |
| Target ID |
T17234
|
| Target Name |
HCMV Serine/threonine protein kinase (UL97) |
| Gene Name |
UL97 |
| Species |
Human cytomegalovirus |
| UniProt ID |
UL97_HCMVA |
| Sequence |
MSSALRSRARSASLGTTTQGWDPPPLRRPSRARRRQWMREAAQAAAQAAVQAAQAAAAQV
AQAHVDENEVVDLMADEAGGGVTTLTTLSSVSTTTVLGHATFSACVRSDVMRDGEKEDAA
SDKENLRRPVVPSTSSRGSAASGDGYHGLRCRETSAMWSFEYDRDGDVTSVRRALFTGGS
DPSDSVSGVRGGRKRPLRPPLVSLARTPLCRRRVGGVDAVLEENDVELRAESQDSAVASG
PGRIPQPLSGSSGEESATAVEADSTSHDDVHCTCSNDQIITTSIRGLTCDPRMFLRLTHP
ELCELSISYLLVYVPKEDDFCHKICYAVDMSDESYRLGQGSFGEVWPLDRYRVVKVARKH
SETVLTVWMSGLIRTRAAGEQQQPPSLVGTGVHRGLLTATGCCLLHNVTVHRRFHTDMFH
HDQWKLACIDSYRRAFCTLADAIKFLNHQCRVCHFDITPMNVLIDVNPHNPSEIVRAALC
DYSLSEPYPDYNERCVAVFQETGTARRIPNCSHRLRECYHPAFRPMPLQKLLICDPHARF
PVAGLRRYCMSELSALGNVLGFCLMRLLDRRGLDEVRMGTEALLFKHAGAACRALENGKL
THCSDACLLILAAQMSYGACLLGEHGAALVSHTLRFVEAKMSSCRVRAFRRFYHECSQTM
LHEYVRKNVERLLATSDGLYLYNAFRRTTSIICEEDLDGDCRQLFPE [Human cytom
egalovirus]
|
| Drug and Corresponding Resistance Mutations |
| Mutation Info |
Missense: A594 |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
|
| Mutation Info |
Missense: A594V |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
26.43% of the specimens |
|
| Mutation Info |
Missense: C518Y |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[3] |
| Targeted Disease |
Bacterial infection |
|
| Mutation Info |
Missense: C592G |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
10.34% of the specimens |
|
| Mutation Info |
Missense: C603W |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
6.89% of the specimens |
|
| Mutation Info |
Missense: C607F |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[3] |
| Targeted Disease |
Bacterial infection |
|
| Mutation Info |
Missense: D605E |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[3] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
30 out of 70 |
|
| Mutation Info |
Missense: E596G |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
1.14% of the specimens |
|
| Mutation Info |
Missense: H520Q |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
18.39% of the specimens |
|
| Mutation Info |
Missense: L595S |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
2.29% of the specimens |
|
| Mutation Info |
Missense: L595W |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[3] |
| Targeted Disease |
Bacterial infection |
|
| Mutation Info |
Missense: M460I |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
9.19% of the specimens |
|
| Mutation Info |
Missense: M460V |
| Drugs |
| Drug Name |
Ganciclovir |
Drug Info
|
[1], [2] |
| Targeted Disease |
Bacterial infection |
| Mutation Prevalence |
3.3% of patients |
|
| References |
| REF 1 |
Assessment of the Human Cytomegalovirus UL97 Gene for Identification of Resistance to Ganciclovir in Iranian Immunosuppressed Patients. Jundishapur J Microbiol. 2016 May 29;9(5):e31733.
|
| REF 2 |
[Investigation of ganciclovir resistance in CMV UL54 and UL97 gene regions in immunocompromised patients receiving gancyclovir treatment].Mikrobiyol Bul.2015 Jul;49(3):393-402.
|
| REF 3 |
A new mutation in the human cytomegalovirus UL97 gene may confer ganciclovir resistance in Chinese kidney transplant recipients.Arch Virol.2013 Jan;158(1):247-50.
|
