Resistance mutation info of target

Target General Information
Target ID T56518
Target Name HBV Reverse transcriptase Target Info
Species Hepatitis B virus genotype B (HBV-B)
Uniprot ID DPOL_HBVB5(347-690)
Sequence EDWGPCTEHGEHRIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNTRVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSR
IINNQHRTMQNLHNSCSRNLYVSLMLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLL
AQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYAAVTNFLLSLGIHLNPHKT
KRWGYSLNFMGYVIGSWGTLPQEHIVQKIKMCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQ [Hepatitis B vi
rus genotype B (HBV-B)]
Drug Resistance Mutation and Corresponding Drugs
Ref 536994Nucleoside and nucleotide analogs in the treatment of chronic hepatitis B. Enferm Infecc Microbiol Clin. 2008 May;26 Suppl 7:32-8.
Ref 536414Telbivudine: a new option for the treatment of chronic hepatitis B. Expert Opin Biol Ther. 2007 May;7(5):751-61.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 1572605The ChEMBL database in 2017.
Mutation Info Missense: A181V
Drugs
Drug Name Adefovir Dipivoxil Drug Info [556006], [556146]
Targeted Disease HBV infection
Mutation Prevalence 843 out of 11751 patients
Mutation Info Missense: A194T
Drugs
Drug Name Tenofovir Disoproxil Fumarate Drug Info [556113]
Targeted Disease HBV infection
Mutation Prevalence 2 out of 317 patients
Mutation Info Missense: L180M
Drugs
Drug Name Famciclovir Drug Info [555526]
Targeted Disease HBV infection
Mutation Info Missense: M204I
Drugs
Drug Name Telbivudine Drug Info [556113]
Targeted Disease HBV infection
Mutation Info Missense: M204V
Drugs
Drug Name Lamivudine Drug Info [556146]
Targeted Disease HBV infection
Mutation Info Missense: M204V/I + A181V
Drugs
Drug Name Entecavir + Lamivudine + Adefovir Drug Info [556146]
Targeted Disease HBV infection
Mutation Info Missense: M204V/I + M250
Drugs
Drug Name Entecavir Drug Info [556146]
Targeted Disease HBV infection
Mutation Info Missense: M204V/I + N236T
Drugs
Drug Name Entecavir + Lamivudine + Adefovir Drug Info [556146]
Targeted Disease HBV infection
Mutation Info Missense: M204V/I + T184 + S202
Drugs
Drug Name Entecavir Drug Info [556146]
Targeted Disease HBV infection
Mutation Prevalence 78 out of 11751 patients
Drug Name Adefovir Dipivoxil Drug Info [556146]
Targeted Disease HBV infection
Mutation Info Missense: N236T
Drugs
Drug Name Adefovir Dipivoxil Drug Info [556006], [556146]
Targeted Disease HBV infection
Mutation Prevalence 538 out of 11751 patients
Mutation Info Missense: V173L
Drugs
Drug Name Famciclovir Drug Info [555526]
Targeted Disease HBV infection
Reference
Ref 555526The hepatitis B virus polymerase mutation rtV173L is selected during lamivudine therapy and enhances viral replication in vitro. J Virol. 2003 Nov;77(21):11833-41.
Ref 556006Screening and identification of a novel adefovir dipivoxil resistance associated mutation, rtN236V, of HBV from a large cohort of HBV-infected patients. Antivir Ther. 2014;19(6):551-8. doi: 10.3851/IMP2775. Epub 2014 Apr 8.
Ref 556113Drug-resistant mutations in hepatitis B virus found in chronic HBV carriers using PCR sequencing technology
Ref 556146Comparison of Detection Rate and Mutational Pattern of Drug-Resistant Mutations Between a Large Cohort of Genotype B and Genotype C Hepatitis B Virus-Infected Patients in North China. Microb Drug Resist. 2017 Jun;23(4):516-522. doi: 10.1089/mdr.2016.0093. Epub 2016 Oct 28.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.