Resistance mutation info of target

Target General Information
Target ID T95678
Target Name Influenza Proton channel protein (M2) Target Info
Gene Name M2
Species Influenza A viruses H1N1
Uniprot ID M2_I35A3
Sequence MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLK
RGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE [Influenza A viruses H
1N1]
Drug Resistance Mutation and Corresponding Drugs
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 467472(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4128).
Ref 537115Emerging treatments for traumatic brain injury. Expert Opin Emerg Drugs. 2009 Mar;14(1):67-84.
Ref 467588(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4253).
Ref 528380Treatment effect size of memantine therapy in Alzheimer disease and vascular dementia. Alzheimer Dis Assoc Disord. 2006 Jul-Sep;20(3):133-7.
Mutation Info Missense: S31N
Drugs
Drug Name Memantine Drug Info [556136]
Targeted Disease Influenza virus infection
Drug Name Amantadine Drug Info [556158], [1559258]
Targeted Disease Influenza virus infection
Drug Name Oseltamivir Drug Info [556158]
Targeted Disease Influenza virus infection
Reference
Ref 556136Discovery of Potential, Non-Toxic Influenza Virus Inhibitor by Computational Techniques. Mol Inform. 2014 Aug;33(8):559-65. doi: 10.1002/minf.201400041. Epub 2014 Jul 24.
Ref 556158Design and expeditious synthesis of organosilanes as potent antivirals targeting multidrug-resistant influenza A viruses. Eur J Med Chem. 2017 Jul 28;135:70-76. doi: 10.1016/j.ejmech.2017.04.038. Epub 2017 Apr 20.
Ref 1559258Investigation of a recent rise of dual amantadine-resistance mutations in the influenza A M2 sequence.BMC Genet.2015;16 Suppl 2:S3.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.