Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T01318
|
||||
Former ID |
TTDS00059
|
||||
Target Name |
Dihydroorotate dehydrogenase, mitochondrial
|
||||
Gene Name |
PFF0160c
|
||||
Synonyms |
DHOD; DHODH; DHODase; DHOdehase; Dihydroorotate dehydrogenase ; Dihydroorotate oxidase; Mitochondrially bound dihydroorotate-ubiqui oxidoreductase; PFF0160c
|
||||
Target Type |
Successful
|
||||
Disease | Fungal infections [ICD9: 110-118; ICD10: B35-B49] | ||||
Malaria [ICD10: B54] | |||||
Multiple scierosis; Active rheumatoid arthritis [ICD9:340, 714; ICD10: G35, M05, M06] | |||||
Function |
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.
|
||||
BioChemical Class |
Oxidoreductases acting on CH-CH group of donors
|
||||
Target Validation |
T01318
|
||||
UniProt ID | |||||
EC Number |
EC 1.3.5.2
|
||||
Sequence |
MISKLKPQFMFLPKKHILSYCRKDVLNLFEQKFYYTSKRKESNNMKNESLLRLINYNRYY
NKIDSNNYYNGGKILSNDRQYIYSPLCEYKKKINDISSYVSVPFKINIRNLGTSNFVNNK KDVLDNDYIYENIKKEKSKHKKIIFLLFVSLFGLYGFFESYNPEFFLYDIFLKFCLKYID GEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKL GFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEED KLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNTPGLRDNQEAGKL KNIILSVKEEIDNLEKNNIMNDESTYNEDNKIVEKKNNFNKNNSHMMKDAKDNFLWFNTT KKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAK LKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAV QIKRELNHLLYQRGYYNLKEAIGRKHSKS |
||||
Structure |
1D3G; 1D3H; 2B0M; 2BXV; 2FPT; 2FPV; 2FPY; 2FQI; 2PRH; 2PRL; 2PRM; 2WV8; 3F1Q; 3FJ6; 3FJL; 3G0U; 3G0X; 3KVJ; 3KVK; 3KVL; 3KVM; 3U2O; 3W7R; 3ZWS; 3ZWT; 4IGH; 4JGD; 4JS3; 4JTS; 4JTT; 4JTU; 4LS0; 4LS1; 4LS2; 4OQV
|
||||
Drugs and Mode of Action | |||||
Inhibitor | 1,4-Naphthoquinone | Drug Info | [534955] | ||
1-hydroxy-2-dodecyl-4(1H)quinolone | Drug Info | [529879] | |||
2-(2-bromo-2-naphthamido)benzoic acid | Drug Info | [527807] | |||
2-(2-naphthamido)benzoic acid | Drug Info | [527807] | |||
2-(3-(3,5-dichlorophenyl)ureido)benzoic acid | Drug Info | [530724] | |||
2-[(biphenyl-4-carbonyl)-amino]-benzoic acid | Drug Info | [527807] | |||
3,6,9,12,15-PENTAOXATRICOSAN-1-OL | Drug Info | [551374] | |||
3-hydroxy-2-phenylquinoline-4-carboxylic acid | Drug Info | [528605] | |||
5,8-hydroxy-naphthoquinone | Drug Info | [534955] | |||
5-Fluoro orotate | Drug Info | [535811] | |||
8-aminoquinolines | Drug Info | [537905] | |||
A77-1726 (monosodium salt) | Drug Info | [535028], [538136] | |||
Acetate Ion | Drug Info | [551393] | |||
Antimycin A | Drug Info | [537862] | |||
Antiproliferative Agent A771726 | Drug Info | [551393] | |||
Artemisinin | Drug Info | [536602] | |||
Atovaquone | Drug Info | [534955], [534960], [535931], [537905] | |||
B-Octylglucoside | Drug Info | [551393] | |||
Cinchoninic acid | Drug Info | [534955] | |||
Cyanide | Drug Info | [537862] | |||
Decylamine-N,N-Dimethyl-N-Oxide | Drug Info | [551393] | |||
Dichloroally-lawsone | Drug Info | [534955] | |||
Dichloroallyl lawsone | Drug Info | [535540] | |||
Diethyl 2-((biphenyl-3-ylamino)methylene)malonate | Drug Info | [528617] | |||
Dihydroorotate | Drug Info | [537699] | |||
DSM1 | Drug Info | [530805] | |||
DSM2 | Drug Info | [530805] | |||
Ethyl 3-(biphenyl-3-ylamino)-2-cyanoacrylate | Drug Info | [528617] | |||
GNF-PF-85 | Drug Info | [529511] | |||
Isoxazol | Drug Info | [534955] | |||
Juglon | Drug Info | [534955] | |||
Lauryl Dimethylamine-N-Oxide | Drug Info | [551393] | |||
Leflunomide | Drug Info | [534936], [537837], [538007], [538113] | |||
LY214352 | Drug Info | [537964] | |||
N-(3,5-dichlorophenyl)-2-methyl-3-nitrobenzamide | Drug Info | [528617] | |||
N-(4-bromo-2-methylphenyl)-2-naphthamide | Drug Info | [528617] | |||
N-(Biphenyl-4-yl)-2-cyano-3-hydroxybut-2-enamide | Drug Info | [530060] | |||
NSC 665564 | Drug Info | [537969] | |||
Orotate | Drug Info | [535811] | |||
Orotic acid | Drug Info | [537699] | |||
Plumbagin | Drug Info | [534955] | |||
Polyporic acid | Drug Info | [534955] | |||
Redoxal | Drug Info | [534956], [535540] | |||
RS-61980 | Drug Info | [537837] | |||
Salicylhydroxamic acid | Drug Info | [537862] | |||
Triazine | Drug Info | [534955] | |||
UNDECYLAMINE-N,N-DIMETHYL-N-OXIDE | Drug Info | [551374] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Pyrimidine metabolism | ||||
Metabolic pathways | |||||
PathWhiz Pathway | Pyrimidine Metabolism | ||||
Reactome | Pyrimidine biosynthesis | ||||
WikiPathways | Metabolism of nucleotides | ||||
References | |||||
Ref 527807 | Bioorg Med Chem Lett. 2006 Jan 1;16(1):88-92. Epub 2005 Oct 19.The first de novo designed inhibitors of Plasmodium falciparum dihydroorotate dehydrogenase. | ||||
Ref 528605 | J Med Chem. 2007 Jan 11;50(1):21-39.Synthesis and biological evaluation of quinoline salicylic acids as P-selectin antagonists. | ||||
Ref 528617 | J Med Chem. 2007 Jan 25;50(2):186-91.Design and synthesis of potent inhibitors of the malaria parasite dihydroorotate dehydrogenase. | ||||
Ref 529511 | J Med Chem. 2008 Jun 26;51(12):3649-53. Epub 2008 Jun 4.Triazolopyrimidine-based dihydroorotate dehydrogenase inhibitors with potent and selective activity against the malaria parasite Plasmodium falciparum. | ||||
Ref 529879 | Bioorg Med Chem Lett. 2009 Feb 1;19(3):972-5. Epub 2008 Nov 24.Type II NADH dehydrogenase of the respiratory chain of Plasmodium falciparum and its inhibitors. | ||||
Ref 530060 | J Med Chem. 2009 May 14;52(9):2683-93.Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases. | ||||
Ref 530724 | Bioorg Med Chem Lett. 2010 Mar 15;20(6):1981-4. Epub 2010 Jan 25.Discovery of novel inhibitors for DHODH via virtual screening and X-ray crystallographic structures. | ||||
Ref 530805 | Plasmodium dihydroorotate dehydrogenase: a promising target for novel anti-malarial chemotherapy. Infect Disord Drug Targets. 2010 Jun;10(3):226-39. | ||||
Ref 534936 | Identification and characterization of potential new therapeutic targets in inflammatory and autoimmune diseases. Eur J Biochem. 1999 Dec;266(3):1184-91. | ||||
Ref 534955 | Kinetics of inhibition of human and rat dihydroorotate dehydrogenase by atovaquone, lawsone derivatives, brequinar sodium and polyporic acid. Chem Biol Interact. 2000 Jan 3;124(1):61-76. | ||||
Ref 534956 | Redoxal as a new lead structure for dihydroorotate dehydrogenase inhibitors: a kinetic study of the inhibition mechanism. FEBS Lett. 2000 Feb 4;467(1):27-30. | ||||
Ref 534960 | Effects of atovaquone and diospyrin-based drugs on the cellular ATP of Pneumocystis carinii f. sp. carinii. Antimicrob Agents Chemother. 2000 Mar;44(3):713-9. | ||||
Ref 535028 | Expression and characterization of E. coli-produced soluble, functional human dihydroorotate dehydrogenase: a potential target for immunosuppression. J Mol Microbiol Biotechnol. 1999 Aug;1(1):183-8. | ||||
Ref 535540 | Malarial dihydroorotate dehydrogenase. Substrate and inhibitor specificity. J Biol Chem. 2002 Nov 1;277(44):41827-34. Epub 2002 Aug 19. | ||||
Ref 535811 | Antimalarial activity of orotate analogs that inhibit dihydroorotase and dihydroorotate dehydrogenase. Biochem Pharmacol. 1992 Mar 17;43(6):1295-301. | ||||
Ref 535931 | Inhibitor binding in a class 2 dihydroorotate dehydrogenase causes variations in the membrane-associated N-terminal domain. Protein Sci. 2004 Apr;13(4):1031-42. | ||||
Ref 536602 | The fight against drug-resistant malaria: novel plasmodial targets and antimalarial drugs. Curr Med Chem. 2008;15(2):161-71. | ||||
Ref 537699 | Structure-activity relationships of pyrimidines as dihydroorotate dehydrogenase inhibitors. Biochem Pharmacol. 1988 Oct 15;37(20):3807-16. | ||||
Ref 537837 | Inhibition of dihydroorotate dehydrogenase by the immunosuppressive agent leflunomide. Biochem Pharmacol. 1995 Sep 7;50(6):861-7. | ||||
Ref 537862 | Effects of atovaquone and other inhibitors on Pneumocystis carinii dihydroorotate dehydrogenase. Antimicrob Agents Chemother. 1995 Feb;39(2):325-8. | ||||
Ref 537905 | The effects of antimalarials on the Plasmodium falciparum dihydroorotate dehydrogenase. Exp Parasitol. 1994 Aug;79(1):50-6. | ||||
Ref 537964 | Identification of a new antifungal target site through a dual biochemical and molecular-genetics approach. Curr Genet. 1996 Jul 31;30(2):159-65. | ||||
Ref 537969 | Identification of a novel inhibitor (NSC 665564) of dihydroorotate dehydrogenase with a potency equivalent to brequinar. Biochem Biophys Res Commun. 1996 Jun 25;223(3):654-9. | ||||
Ref 538007 | Dihydroorotate dehydrogenase is a target for the biological effects of leflunomide. Transplant Proc. 1996 Dec;28(6):3088-91. | ||||
Ref 538113 | Expression, purification, and characterization of histidine-tagged rat and human flavoenzyme dihydroorotate dehydrogenase. Protein Expr Purif. 1998 Aug;13(3):414-22. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.