Target General Infomation
Target ID
T14912
Former ID
TTDC00048
Target Name
Induced myeloid leukemia cell differentiation protein Mcl-1
Gene Name
MCL1
Synonyms
Bcl-2-related protein EAT/mcl1; mcl1/EAT; MCL1
Target Type
Clinical Trial
Disease Cancer [ICD9: 140-229; ICD10: C00-C96]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Trematode infection [ICD10: B66.9]
BioChemical Class
Bcl-2 family
Target Validation
T14912
UniProt ID
Sequence
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Drugs and Mode of Action
Drug(s) Obatoclax Drug Info Phase 2 Solid tumours [531104]
BITHIONOL Drug Info Withdrawn from market Trematode infection [539482], [551871]
Inhibitor ALTENUSIN Drug Info [531262]
AMENTOFLAVONE Drug Info [531262]
BITHIONOL Drug Info [531262]
CEPHALOCHROMIN Drug Info [531262]
EU-517 Drug Info [543733]
GNF-PF-1591 Drug Info [531262]
GNF-PF-3955 Drug Info [531262]
GNF-PF-5134 Drug Info [531262]
MORIN Drug Info [531262]
NSC-180246 Drug Info [531262]
NSC-66209 Drug Info [531262]
Obatoclax Drug Info [531104]
QEDIIRNIARHLAQVGDSMDR Drug Info [528469]
ROSMARINIC ACID Drug Info [531262]
SULFURETIN Drug Info [531262]
TW-37 Drug Info [528469]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway PI3K-Akt signaling pathway
MicroRNAs in cancer
NetPath Pathway TCR Signaling Pathway
PANTHER Pathway Apoptosis signaling pathway
CCKR signaling map ST
Pathway Interaction Database E2F transcription factor network
Direct p53 effectors
IL6-mediated signaling events
HIF-1-alpha transcription factor network
WikiPathways Apoptosis
miR-targeted genes in muscle cell - TarBase
miR-targeted genes in lymphocytes - TarBase
miR-targeted genes in leukocytes - TarBase
Apoptosis Modulation and Signaling
References
Ref 531104Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9.
Ref 539482(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2338).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 528469J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins.
Ref 531104Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9.
Ref 531262Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2).
Ref 543733(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2847).
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.